BLASTX nr result
ID: Glycyrrhiza24_contig00023386
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza24_contig00023386 (441 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003638451.1| hypothetical protein MTR_132s0010, partial [... 65 7e-09 ref|XP_003636862.1| hypothetical protein MTR_063s0020 [Medicago ... 64 1e-08 >ref|XP_003638451.1| hypothetical protein MTR_132s0010, partial [Medicago truncatula] gi|355504386|gb|AES85589.1| hypothetical protein MTR_132s0010, partial [Medicago truncatula] Length = 1458 Score = 64.7 bits (156), Expect = 7e-09 Identities = 44/121 (36%), Positives = 54/121 (44%) Frame = -3 Query: 409 EMAHA*VLINPPKPHKGGQDGKSLISRTNTIQPVENTGATNKHQRHTGTR*KLDRFACRP 230 E A LIN P G R N + + ++ + G C+P Sbjct: 1232 EPASTFYLINASLPKVGVCYKHMTTGRINQVASINDSAHRESFEPTKGA------IICKP 1285 Query: 229 FDAKARSQPAQATELPLTRPHVCLTQRHQTNHTPQCRKAREHMEASNGAASAALGMT*VE 50 F AKA SQ Q + LPLT P VC Q T+ TP +A HMEASN A SA+L M E Sbjct: 1286 FKAKALSQQTQTSTLPLTCPRVCKNQHRGTHPTPHNAEACRHMEASNNADSASLSMKIKE 1345 Query: 49 T 47 T Sbjct: 1346 T 1346 >ref|XP_003636862.1| hypothetical protein MTR_063s0020 [Medicago truncatula] gi|355502797|gb|AES84000.1| hypothetical protein MTR_063s0020 [Medicago truncatula] Length = 100 Score = 64.3 bits (155), Expect = 1e-08 Identities = 33/62 (53%), Positives = 38/62 (61%) Frame = -3 Query: 247 RFACRPFDAKARSQPAQATELPLTRPHVCLTQRHQTNHTPQCRKAREHMEASNGAASAAL 68 R C+PF AKA SQ Q + LPLT P VC Q T+ TP +A HMEASN A SA+L Sbjct: 3 RIICKPFKAKALSQQTQTSTLPLTCPRVCKNQHRGTHPTPHNAEACRHMEASNNADSASL 62 Query: 67 GM 62 M Sbjct: 63 SM 64