BLASTX nr result
ID: Glycyrrhiza24_contig00023376
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza24_contig00023376 (265 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003601024.1| Speckle-type POZ protein-like protein [Medic... 100 7e-23 ref|XP_003552826.1| PREDICTED: BTB/POZ domain-containing protein... 102 1e-22 ref|XP_002520826.1| protein binding protein, putative [Ricinus c... 68 7e-10 ref|NP_191182.1| BTB/POZ domain-containing protein [Arabidopsis ... 65 4e-09 ref|XP_003633433.1| PREDICTED: BTB/POZ domain-containing protein... 62 4e-08 >ref|XP_003601024.1| Speckle-type POZ protein-like protein [Medicago truncatula] gi|355490072|gb|AES71275.1| Speckle-type POZ protein-like protein [Medicago truncatula] Length = 273 Score = 100 bits (250), Expect(2) = 7e-23 Identities = 47/61 (77%), Positives = 51/61 (83%) Frame = +3 Query: 42 MDCCVCTTMPLILRPPRNTICGTCYEGVRNMINMMNNHESEKAKAITNDPKGSPAPRRNS 221 MDCCVCTTMPLILRPPRNTICG CYEGVR++INMMN E+EKAK IT P SP RRNS Sbjct: 1 MDCCVCTTMPLILRPPRNTICGACYEGVRSIINMMNGLETEKAKTITT-PNDSPVSRRNS 59 Query: 222 N 224 + Sbjct: 60 S 60 Score = 31.2 bits (69), Expect(2) = 7e-23 Identities = 11/15 (73%), Positives = 14/15 (93%) Frame = +1 Query: 220 RTIDDCIRLCSEQID 264 +T+DDC+R CSEQID Sbjct: 61 KTLDDCVRWCSEQID 75 >ref|XP_003552826.1| PREDICTED: BTB/POZ domain-containing protein At3g56230-like [Glycine max] Length = 269 Score = 102 bits (254), Expect(2) = 1e-22 Identities = 47/62 (75%), Positives = 53/62 (85%), Gaps = 1/62 (1%) Frame = +3 Query: 42 MDCCVCTTMPLILRPPRNTICGTCYEGVRNMINMMNNHESEKAKAITN-DPKGSPAPRRN 218 MDCCVCTTMPLILRPPRNTICG CYEGVR++INMM+N ESEK KA+ N +P SP RRN Sbjct: 1 MDCCVCTTMPLILRPPRNTICGACYEGVRSIINMMSNVESEKVKAMANPNPNSSPVSRRN 60 Query: 219 SN 224 S+ Sbjct: 61 SS 62 Score = 28.9 bits (63), Expect(2) = 1e-22 Identities = 10/15 (66%), Positives = 14/15 (93%) Frame = +1 Query: 220 RTIDDCIRLCSEQID 264 +T+DDCIR CSEQ++ Sbjct: 63 KTLDDCIRWCSEQME 77 >ref|XP_002520826.1| protein binding protein, putative [Ricinus communis] gi|223539957|gb|EEF41535.1| protein binding protein, putative [Ricinus communis] Length = 267 Score = 68.2 bits (165), Expect = 7e-10 Identities = 26/42 (61%), Positives = 34/42 (80%) Frame = +3 Query: 42 MDCCVCTTMPLILRPPRNTICGTCYEGVRNMINMMNNHESEK 167 MDC +C++MP ILRPPRNTICG CYEG + +I +MN +S+K Sbjct: 1 MDCSICSSMPTILRPPRNTICGACYEGAKTVITLMNKFDSDK 42 >ref|NP_191182.1| BTB/POZ domain-containing protein [Arabidopsis thaliana] gi|75264422|sp|Q9LYL9.1|Y3623_ARATH RecName: Full=BTB/POZ domain-containing protein At3g56230 gi|7572921|emb|CAB87422.1| putative protein [Arabidopsis thaliana] gi|45825155|gb|AAS77485.1| At3g56230 [Arabidopsis thaliana] gi|51970740|dbj|BAD44062.1| putative protein [Arabidopsis thaliana] gi|332645978|gb|AEE79499.1| BTB/POZ domain-containing protein [Arabidopsis thaliana] Length = 282 Score = 65.5 bits (158), Expect = 4e-09 Identities = 27/42 (64%), Positives = 31/42 (73%) Frame = +3 Query: 42 MDCCVCTTMPLILRPPRNTICGTCYEGVRNMINMMNNHESEK 167 MDC +CTTMP ILRPPRNTICG+CYEG R I ++ E K Sbjct: 1 MDCSICTTMPSILRPPRNTICGSCYEGARTTIALLKKLEGSK 42 >ref|XP_003633433.1| PREDICTED: BTB/POZ domain-containing protein At3g56230-like [Vitis vinifera] Length = 270 Score = 62.4 bits (150), Expect = 4e-08 Identities = 26/55 (47%), Positives = 37/55 (67%) Frame = +3 Query: 42 MDCCVCTTMPLILRPPRNTICGTCYEGVRNMINMMNNHESEKAKAITNDPKGSPA 206 MDC +C+ +P ILRPPRNTIC CYE R+++ +N E++K +N+ SPA Sbjct: 1 MDCSICSAVPFILRPPRNTICAACYESARSIVAFINKLENDKGFDKSNNSIVSPA 55