BLASTX nr result
ID: Glycyrrhiza24_contig00023204
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza24_contig00023204 (317 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003593650.1| hypothetical protein MTR_2g014570 [Medicago ... 81 8e-14 gb|ABN08716.1| SAM (and some other nucleotide) binding motif [Me... 81 8e-14 ref|XP_003543023.1| PREDICTED: tRNA (adenine-N(1)-)-methyltransf... 72 4e-11 gb|ACU19970.1| unknown [Glycine max] 67 1e-09 ref|XP_002521442.1| tRNA, putative [Ricinus communis] gi|2235393... 59 5e-07 >ref|XP_003593650.1| hypothetical protein MTR_2g014570 [Medicago truncatula] gi|355482698|gb|AES63901.1| hypothetical protein MTR_2g014570 [Medicago truncatula] Length = 66 Score = 81.3 bits (199), Expect = 8e-14 Identities = 37/42 (88%), Positives = 38/42 (90%) Frame = -1 Query: 317 RRQCSDGNYVLSGTTTSVMARPCGEARGHTGYLTFARLKCLS 192 RRQCSDGNYVLS T+SVMARPC EARGHTGYLTFARLKC S Sbjct: 25 RRQCSDGNYVLSNPTSSVMARPCDEARGHTGYLTFARLKCFS 66 >gb|ABN08716.1| SAM (and some other nucleotide) binding motif [Medicago truncatula] Length = 307 Score = 81.3 bits (199), Expect = 8e-14 Identities = 37/42 (88%), Positives = 38/42 (90%) Frame = -1 Query: 317 RRQCSDGNYVLSGTTTSVMARPCGEARGHTGYLTFARLKCLS 192 RRQCSDGNYVLS T+SVMARPC EARGHTGYLTFARLKC S Sbjct: 266 RRQCSDGNYVLSNPTSSVMARPCDEARGHTGYLTFARLKCFS 307 >ref|XP_003543023.1| PREDICTED: tRNA (adenine-N(1)-)-methyltransferase catalytic subunit TRMT61A-like [Glycine max] Length = 309 Score = 72.4 bits (176), Expect = 4e-11 Identities = 35/45 (77%), Positives = 40/45 (88%), Gaps = 3/45 (6%) Frame = -1 Query: 317 RRQCSDGNYVLSGTT---TSVMARPCGEARGHTGYLTFARLKCLS 192 RRQCSDG+YVLS ++ +SVMARPCGEARGHTGYLTFAR+K LS Sbjct: 265 RRQCSDGSYVLSSSSPSISSVMARPCGEARGHTGYLTFARVKSLS 309 >gb|ACU19970.1| unknown [Glycine max] Length = 60 Score = 67.4 bits (163), Expect = 1e-09 Identities = 33/45 (73%), Positives = 38/45 (84%), Gaps = 3/45 (6%) Frame = -1 Query: 317 RRQCSDGNYVLSGTT---TSVMARPCGEARGHTGYLTFARLKCLS 192 RRQCSDG+YVLS ++ +SVMA PCGEA GHTGYLTFAR+K LS Sbjct: 16 RRQCSDGSYVLSSSSPSISSVMASPCGEAGGHTGYLTFARVKSLS 60 >ref|XP_002521442.1| tRNA, putative [Ricinus communis] gi|223539341|gb|EEF40932.1| tRNA, putative [Ricinus communis] Length = 311 Score = 58.5 bits (140), Expect = 5e-07 Identities = 27/43 (62%), Positives = 37/43 (86%), Gaps = 1/43 (2%) Frame = -1 Query: 317 RRQCSDGNYVLSGTTTSV-MARPCGEARGHTGYLTFARLKCLS 192 R++ S+G+ V + +++ V MARPCG++RGHTGYLTFARLKCLS Sbjct: 269 RQRSSEGSNVQNSSSSPVIMARPCGDSRGHTGYLTFARLKCLS 311