BLASTX nr result
ID: Glycyrrhiza24_contig00022397
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza24_contig00022397 (211 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003624709.1| CCP [Medicago truncatula] gi|355499724|gb|AE... 132 3e-29 ref|XP_003553346.1| PREDICTED: cationic amino acid transporter 3... 129 3e-28 ref|XP_002525690.1| cationic amino acid transporter, putative [R... 129 3e-28 ref|XP_002888222.1| hypothetical protein ARALYDRAFT_475412 [Arab... 128 5e-28 ref|NP_849822.1| cationic amino acid transporter 2 [Arabidopsis ... 127 1e-27 >ref|XP_003624709.1| CCP [Medicago truncatula] gi|355499724|gb|AES80927.1| CCP [Medicago truncatula] Length = 618 Score = 132 bits (332), Expect = 3e-29 Identities = 66/70 (94%), Positives = 69/70 (98%) Frame = +2 Query: 2 AKELTVPHLIAIGVGSTIGAGVYVLVGTVAREHAGPSLAISFLIAGLAAGLSAFCYAELA 181 AKEL+V HLIAIGVGSTIGAGVYVLVGTVAREH+GP+LAISFLIAGLAAGLSAFCYAELA Sbjct: 33 AKELSVYHLIAIGVGSTIGAGVYVLVGTVAREHSGPALAISFLIAGLAAGLSAFCYAELA 92 Query: 182 CRCPSAGSAY 211 CRCPSAGSAY Sbjct: 93 CRCPSAGSAY 102 >ref|XP_003553346.1| PREDICTED: cationic amino acid transporter 3-like [Glycine max] Length = 641 Score = 129 bits (323), Expect = 3e-28 Identities = 65/70 (92%), Positives = 67/70 (95%) Frame = +2 Query: 2 AKELTVPHLIAIGVGSTIGAGVYVLVGTVAREHAGPSLAISFLIAGLAAGLSAFCYAELA 181 AKELTV HLIA+GVGSTIGAGVYVLVG VAREHAGP+LAISFLIAGLAAGLSAFCYAELA Sbjct: 38 AKELTVLHLIAVGVGSTIGAGVYVLVGAVAREHAGPALAISFLIAGLAAGLSAFCYAELA 97 Query: 182 CRCPSAGSAY 211 RCPSAGSAY Sbjct: 98 SRCPSAGSAY 107 >ref|XP_002525690.1| cationic amino acid transporter, putative [Ricinus communis] gi|223534990|gb|EEF36673.1| cationic amino acid transporter, putative [Ricinus communis] Length = 643 Score = 129 bits (323), Expect = 3e-28 Identities = 63/70 (90%), Positives = 68/70 (97%) Frame = +2 Query: 2 AKELTVPHLIAIGVGSTIGAGVYVLVGTVAREHAGPSLAISFLIAGLAAGLSAFCYAELA 181 AKEL+VPHLIAIGVGSTIGAGVY+LVGTVAREH+GP+LAISFLIAG+AA LSAFCYAELA Sbjct: 44 AKELSVPHLIAIGVGSTIGAGVYILVGTVAREHSGPALAISFLIAGIAAALSAFCYAELA 103 Query: 182 CRCPSAGSAY 211 RCPSAGSAY Sbjct: 104 SRCPSAGSAY 113 >ref|XP_002888222.1| hypothetical protein ARALYDRAFT_475412 [Arabidopsis lyrata subsp. lyrata] gi|297334063|gb|EFH64481.1| hypothetical protein ARALYDRAFT_475412 [Arabidopsis lyrata subsp. lyrata] Length = 635 Score = 128 bits (321), Expect = 5e-28 Identities = 61/70 (87%), Positives = 68/70 (97%) Frame = +2 Query: 2 AKELTVPHLIAIGVGSTIGAGVYVLVGTVAREHAGPSLAISFLIAGLAAGLSAFCYAELA 181 AK LTVPHL+AIGVG+TIGAGVY+LVGTVAREH+GPSLA+SFLIAG+AAGLSAFCYAEL+ Sbjct: 41 AKALTVPHLVAIGVGATIGAGVYILVGTVAREHSGPSLALSFLIAGIAAGLSAFCYAELS 100 Query: 182 CRCPSAGSAY 211 RCPSAGSAY Sbjct: 101 SRCPSAGSAY 110 >ref|NP_849822.1| cationic amino acid transporter 2 [Arabidopsis thaliana] gi|75308011|sp|Q9ASS7.1|CAAT2_ARATH RecName: Full=Cationic amino acid transporter 2, vacuolar gi|13605811|gb|AAK32891.1|AF367304_1 AT5g36940/MLF18_60 [Arabidopsis thaliana] gi|209529757|gb|ACI49773.1| At1g58030 [Arabidopsis thaliana] gi|332195367|gb|AEE33488.1| cationic amino acid transporter 2 [Arabidopsis thaliana] Length = 635 Score = 127 bits (318), Expect = 1e-27 Identities = 60/70 (85%), Positives = 68/70 (97%) Frame = +2 Query: 2 AKELTVPHLIAIGVGSTIGAGVYVLVGTVAREHAGPSLAISFLIAGLAAGLSAFCYAELA 181 A+ LTVPHL+AIGVG+TIGAGVY+LVGTVAREH+GPSLA+SFLIAG+AAGLSAFCYAEL+ Sbjct: 41 ARALTVPHLVAIGVGATIGAGVYILVGTVAREHSGPSLALSFLIAGIAAGLSAFCYAELS 100 Query: 182 CRCPSAGSAY 211 RCPSAGSAY Sbjct: 101 SRCPSAGSAY 110