BLASTX nr result
ID: Glycyrrhiza24_contig00022363
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza24_contig00022363 (297 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003599442.1| Structural maintenance of chromosomes protei... 190 1e-46 ref|XP_003556332.1| PREDICTED: structural maintenance of chromos... 184 6e-45 ref|XP_003609379.1| Structural maintenance of chromosomes protei... 184 6e-45 ref|XP_003613415.1| Structural maintenance of chromosomes protei... 178 5e-43 ref|XP_002517770.1| structural maintenance of chromosomes 5 smc5... 161 6e-38 >ref|XP_003599442.1| Structural maintenance of chromosomes protein [Medicago truncatula] gi|355488490|gb|AES69693.1| Structural maintenance of chromosomes protein [Medicago truncatula] Length = 294 Score = 190 bits (482), Expect = 1e-46 Identities = 94/99 (94%), Positives = 97/99 (97%) Frame = +1 Query: 1 LPQDRVCEFAKLTPVQLLEETEKAVGDPMLPEQHRALIDKSRALKNIELSLEKNEGTLNQ 180 LPQDRVCEFAKLTPVQLLEETEKAVGDP LPEQHRALIDKSRALK++ELSLEKNEGTLNQ Sbjct: 151 LPQDRVCEFAKLTPVQLLEETEKAVGDPQLPEQHRALIDKSRALKHVELSLEKNEGTLNQ 210 Query: 181 LKERNTELEKDVERVRQRDELLAKAESMKKKVPWLRYDM 297 LKERN ELEKDVERVRQRDELLAKAESMKKK+PWLRYDM Sbjct: 211 LKERNAELEKDVERVRQRDELLAKAESMKKKLPWLRYDM 249 >ref|XP_003556332.1| PREDICTED: structural maintenance of chromosomes protein 5-like [Glycine max] Length = 1059 Score = 184 bits (467), Expect = 6e-45 Identities = 91/99 (91%), Positives = 95/99 (95%) Frame = +1 Query: 1 LPQDRVCEFAKLTPVQLLEETEKAVGDPMLPEQHRALIDKSRALKNIELSLEKNEGTLNQ 180 LPQDRVCEFAKLTPVQLLEETEKAVGDP LPEQHRAL+DKSRALK+IELSLEKNEGTL Q Sbjct: 151 LPQDRVCEFAKLTPVQLLEETEKAVGDPQLPEQHRALVDKSRALKHIELSLEKNEGTLKQ 210 Query: 181 LKERNTELEKDVERVRQRDELLAKAESMKKKVPWLRYDM 297 LKERN ELE DVERVRQRDELLAKAE+MKKK+PWLRYDM Sbjct: 211 LKERNAELETDVERVRQRDELLAKAEAMKKKLPWLRYDM 249 >ref|XP_003609379.1| Structural maintenance of chromosomes protein [Medicago truncatula] gi|355510434|gb|AES91576.1| Structural maintenance of chromosomes protein [Medicago truncatula] Length = 364 Score = 184 bits (467), Expect = 6e-45 Identities = 91/99 (91%), Positives = 95/99 (95%) Frame = +1 Query: 1 LPQDRVCEFAKLTPVQLLEETEKAVGDPMLPEQHRALIDKSRALKNIELSLEKNEGTLNQ 180 LPQDRVCEFAKLTPVQLLEETEKAVGDP LPEQHRALIDKSRALK++ELSL KNEGTLNQ Sbjct: 221 LPQDRVCEFAKLTPVQLLEETEKAVGDPRLPEQHRALIDKSRALKHVELSLVKNEGTLNQ 280 Query: 181 LKERNTELEKDVERVRQRDELLAKAESMKKKVPWLRYDM 297 LKERN ELEKDVERVRQRDELL KAESMKKK+PWL+YDM Sbjct: 281 LKERNAELEKDVERVRQRDELLTKAESMKKKLPWLKYDM 319 >ref|XP_003613415.1| Structural maintenance of chromosomes protein [Medicago truncatula] gi|355514750|gb|AES96373.1| Structural maintenance of chromosomes protein [Medicago truncatula] Length = 438 Score = 178 bits (451), Expect = 5e-43 Identities = 88/99 (88%), Positives = 94/99 (94%) Frame = +1 Query: 1 LPQDRVCEFAKLTPVQLLEETEKAVGDPMLPEQHRALIDKSRALKNIELSLEKNEGTLNQ 180 LPQDRVCEFAKLTPVQLLEETEKAVGD LPEQHRALIDKSRALK++ELSLEKNEGTLNQ Sbjct: 152 LPQDRVCEFAKLTPVQLLEETEKAVGDTQLPEQHRALIDKSRALKHVELSLEKNEGTLNQ 211 Query: 181 LKERNTELEKDVERVRQRDELLAKAESMKKKVPWLRYDM 297 LKERN ELEKDVERVRQRDEL AKA+ M+KK+PWL+YDM Sbjct: 212 LKERNAELEKDVERVRQRDELRAKAKLMEKKLPWLKYDM 250 >ref|XP_002517770.1| structural maintenance of chromosomes 5 smc5, putative [Ricinus communis] gi|223543042|gb|EEF44577.1| structural maintenance of chromosomes 5 smc5, putative [Ricinus communis] Length = 1057 Score = 161 bits (407), Expect = 6e-38 Identities = 79/99 (79%), Positives = 88/99 (88%) Frame = +1 Query: 1 LPQDRVCEFAKLTPVQLLEETEKAVGDPMLPEQHRALIDKSRALKNIELSLEKNEGTLNQ 180 LPQDRVCEFAKLTPVQLLEETEKAVGDP LP QHRAL++KSR LKNIE+++E+N TLNQ Sbjct: 158 LPQDRVCEFAKLTPVQLLEETEKAVGDPQLPIQHRALVEKSRELKNIEVAVERNGETLNQ 217 Query: 181 LKERNTELEKDVERVRQRDELLAKAESMKKKVPWLRYDM 297 LK N ELEKDVERVRQR+ELL K E MKKK+PWL+YDM Sbjct: 218 LKALNAELEKDVERVRQREELLEKVEWMKKKLPWLKYDM 256