BLASTX nr result
ID: Glycyrrhiza24_contig00021928
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza24_contig00021928 (718 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFK47445.1| unknown [Lotus japonicus] 72 9e-11 ref|YP_173361.1| hypothetical protein NitaMp013 [Nicotiana tabac... 70 4e-10 >gb|AFK47445.1| unknown [Lotus japonicus] Length = 81 Score = 72.4 bits (176), Expect = 9e-11 Identities = 33/40 (82%), Positives = 36/40 (90%) Frame = +2 Query: 245 MDLYSISNQRISPNEEFPLLCFRAARAWHSLLAERHTGKK 364 MDLYSI NQRISPN EFPL CFR+ARAWHSLLAERHT ++ Sbjct: 1 MDLYSIRNQRISPNYEFPLHCFRSARAWHSLLAERHTEER 40 >ref|YP_173361.1| hypothetical protein NitaMp013 [Nicotiana tabacum] gi|56806523|dbj|BAD83424.1| hypothetical protein (mitochondrion) [Nicotiana tabacum] Length = 112 Score = 70.1 bits (170), Expect = 4e-10 Identities = 36/45 (80%), Positives = 38/45 (84%), Gaps = 2/45 (4%) Frame = +2 Query: 245 MDLYSISNQRISPN--EEFPLLCFRAARAWHSLLAERHTGKKERL 373 MDLYSI NQRISP EEFPLL F +ARAWHSLLAERHT KK+RL Sbjct: 1 MDLYSIRNQRISPQKREEFPLLSFCSARAWHSLLAERHTEKKKRL 45