BLASTX nr result
ID: Glycyrrhiza24_contig00021897
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza24_contig00021897 (633 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003518681.1| PREDICTED: methionine aminopeptidase 1B, chl... 91 2e-16 ref|XP_003516850.1| PREDICTED: methionine aminopeptidase 1B, chl... 90 4e-16 ref|XP_002524411.1| methionine aminopeptidase, putative [Ricinus... 89 5e-16 ref|XP_002311439.1| predicted protein [Populus trichocarpa] gi|2... 86 4e-15 ref|XP_004160592.1| PREDICTED: methionine aminopeptidase 1B, chl... 84 2e-14 >ref|XP_003518681.1| PREDICTED: methionine aminopeptidase 1B, chloroplastic-like [Glycine max] Length = 366 Score = 90.9 bits (224), Expect = 2e-16 Identities = 42/47 (89%), Positives = 45/47 (95%) Frame = +3 Query: 3 PILTMGSIDSITWQDNWTTLTADGSQAAQFEHTILITRTGAEILTSC 143 PIL+MGSIDSITW DNWTTLTADGS AAQFEHTILIT+TGAEILT+C Sbjct: 320 PILSMGSIDSITWPDNWTTLTADGSPAAQFEHTILITKTGAEILTTC 366 >ref|XP_003516850.1| PREDICTED: methionine aminopeptidase 1B, chloroplastic-like [Glycine max] Length = 366 Score = 89.7 bits (221), Expect = 4e-16 Identities = 41/47 (87%), Positives = 44/47 (93%) Frame = +3 Query: 3 PILTMGSIDSITWQDNWTTLTADGSQAAQFEHTILITRTGAEILTSC 143 PIL+MGSIDSITW DNWTT+TADGS AAQFEHTILIT+TGAEILT C Sbjct: 320 PILSMGSIDSITWPDNWTTITADGSPAAQFEHTILITKTGAEILTKC 366 >ref|XP_002524411.1| methionine aminopeptidase, putative [Ricinus communis] gi|223536372|gb|EEF38022.1| methionine aminopeptidase, putative [Ricinus communis] Length = 365 Score = 89.4 bits (220), Expect = 5e-16 Identities = 41/47 (87%), Positives = 43/47 (91%) Frame = +3 Query: 3 PILTMGSIDSITWQDNWTTLTADGSQAAQFEHTILITRTGAEILTSC 143 PILTMGSI+ +TW DNWTTLTADGS AAQFEHTILITRTGAEILT C Sbjct: 319 PILTMGSIECVTWPDNWTTLTADGSPAAQFEHTILITRTGAEILTKC 365 >ref|XP_002311439.1| predicted protein [Populus trichocarpa] gi|222851259|gb|EEE88806.1| predicted protein [Populus trichocarpa] Length = 299 Score = 86.3 bits (212), Expect = 4e-15 Identities = 40/47 (85%), Positives = 42/47 (89%) Frame = +3 Query: 3 PILTMGSIDSITWQDNWTTLTADGSQAAQFEHTILITRTGAEILTSC 143 PILT+GS + ITW DNWTTLTADGS AAQFEHTILITRTGAEILT C Sbjct: 253 PILTIGSTECITWPDNWTTLTADGSPAAQFEHTILITRTGAEILTKC 299 >ref|XP_004160592.1| PREDICTED: methionine aminopeptidase 1B, chloroplastic-like [Cucumis sativus] Length = 369 Score = 84.0 bits (206), Expect = 2e-14 Identities = 40/46 (86%), Positives = 41/46 (89%) Frame = +3 Query: 3 PILTMGSIDSITWQDNWTTLTADGSQAAQFEHTILITRTGAEILTS 140 PILTMG ID TW DNWTTLTADGS AAQFEHTILITRTGAEILT+ Sbjct: 323 PILTMGGIDCRTWPDNWTTLTADGSPAAQFEHTILITRTGAEILTT 368