BLASTX nr result
ID: Glycyrrhiza24_contig00021825
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza24_contig00021825 (203 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003535531.1| PREDICTED: endoplasmic reticulum metallopept... 80 2e-13 ref|XP_003591903.1| Endoplasmic reticulum metallopeptidase [Medi... 79 5e-13 ref|XP_003591902.1| Endoplasmic reticulum metallopeptidase [Medi... 79 5e-13 ref|XP_004166768.1| PREDICTED: endoplasmic reticulum metallopept... 72 5e-11 ref|XP_004142491.1| PREDICTED: endoplasmic reticulum metallopept... 72 5e-11 >ref|XP_003535531.1| PREDICTED: endoplasmic reticulum metallopeptidase 1-like [Glycine max] Length = 912 Score = 80.1 bits (196), Expect = 2e-13 Identities = 37/38 (97%), Positives = 37/38 (97%) Frame = +1 Query: 1 GSFQWLILLTLGNYFKIGSSYLALVWLVSPAFAYGFFE 114 GSFQWLILL LGNYFKIGSSYLALVWLVSPAFAYGFFE Sbjct: 534 GSFQWLILLILGNYFKIGSSYLALVWLVSPAFAYGFFE 571 >ref|XP_003591903.1| Endoplasmic reticulum metallopeptidase [Medicago truncatula] gi|355480951|gb|AES62154.1| Endoplasmic reticulum metallopeptidase [Medicago truncatula] Length = 665 Score = 78.6 bits (192), Expect = 5e-13 Identities = 36/38 (94%), Positives = 37/38 (97%) Frame = +1 Query: 1 GSFQWLILLTLGNYFKIGSSYLALVWLVSPAFAYGFFE 114 GSFQWLILL LGNYFKIGSSYLALVWLVSPAFA+GFFE Sbjct: 539 GSFQWLILLILGNYFKIGSSYLALVWLVSPAFAFGFFE 576 >ref|XP_003591902.1| Endoplasmic reticulum metallopeptidase [Medicago truncatula] gi|355480950|gb|AES62153.1| Endoplasmic reticulum metallopeptidase [Medicago truncatula] Length = 917 Score = 78.6 bits (192), Expect = 5e-13 Identities = 36/38 (94%), Positives = 37/38 (97%) Frame = +1 Query: 1 GSFQWLILLTLGNYFKIGSSYLALVWLVSPAFAYGFFE 114 GSFQWLILL LGNYFKIGSSYLALVWLVSPAFA+GFFE Sbjct: 539 GSFQWLILLILGNYFKIGSSYLALVWLVSPAFAFGFFE 576 >ref|XP_004166768.1| PREDICTED: endoplasmic reticulum metallopeptidase 1-like, partial [Cucumis sativus] Length = 637 Score = 72.0 bits (175), Expect = 5e-11 Identities = 32/38 (84%), Positives = 34/38 (89%) Frame = +1 Query: 1 GSFQWLILLTLGNYFKIGSSYLALVWLVSPAFAYGFFE 114 GSFQWLI L +GNY+KIGSSYLALVWLVSPAFAYG E Sbjct: 257 GSFQWLIFLIIGNYYKIGSSYLALVWLVSPAFAYGLLE 294 >ref|XP_004142491.1| PREDICTED: endoplasmic reticulum metallopeptidase 1-like [Cucumis sativus] Length = 908 Score = 72.0 bits (175), Expect = 5e-11 Identities = 32/38 (84%), Positives = 34/38 (89%) Frame = +1 Query: 1 GSFQWLILLTLGNYFKIGSSYLALVWLVSPAFAYGFFE 114 GSFQWLI L +GNY+KIGSSYLALVWLVSPAFAYG E Sbjct: 528 GSFQWLIFLIIGNYYKIGSSYLALVWLVSPAFAYGLLE 565