BLASTX nr result
ID: Glycyrrhiza24_contig00021627
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza24_contig00021627 (328 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003529726.1| PREDICTED: putative phospholipid-transportin... 75 7e-12 ref|XP_003531605.1| PREDICTED: putative phospholipid-transportin... 72 6e-11 ref|XP_003543582.1| PREDICTED: putative phospholipid-transportin... 68 7e-10 ref|XP_003546722.1| PREDICTED: putative phospholipid-transportin... 67 1e-09 ref|XP_003627157.1| Aminophospholipid ATPase [Medicago truncatul... 63 3e-08 >ref|XP_003529726.1| PREDICTED: putative phospholipid-transporting ATPase 4-like [Glycine max] Length = 1224 Score = 74.7 bits (182), Expect = 7e-12 Identities = 33/36 (91%), Positives = 36/36 (100%) Frame = +3 Query: 219 MTRGRIRAKLRRSNLYTFGCLRPTTTEEAPHPLQGP 326 MTRGRIRAKLRRS+LYTFGCL+P+TTEEAPHPLQGP Sbjct: 1 MTRGRIRAKLRRSHLYTFGCLKPSTTEEAPHPLQGP 36 >ref|XP_003531605.1| PREDICTED: putative phospholipid-transporting ATPase 4-like [Glycine max] Length = 1224 Score = 71.6 bits (174), Expect = 6e-11 Identities = 31/36 (86%), Positives = 35/36 (97%) Frame = +3 Query: 219 MTRGRIRAKLRRSNLYTFGCLRPTTTEEAPHPLQGP 326 MTRGRIRA+LRRS+LYTFGCL+P+TTEEAPHPL GP Sbjct: 1 MTRGRIRARLRRSHLYTFGCLKPSTTEEAPHPLNGP 36 >ref|XP_003543582.1| PREDICTED: putative phospholipid-transporting ATPase 4-like [Glycine max] Length = 1224 Score = 68.2 bits (165), Expect = 7e-10 Identities = 32/37 (86%), Positives = 34/37 (91%), Gaps = 1/37 (2%) Frame = +3 Query: 219 MTRGRIRAKLRRSNLYTFG-CLRPTTTEEAPHPLQGP 326 M RGRIRA+LRRS+LYTFG CLRPTTTEE PHPLQGP Sbjct: 1 MARGRIRARLRRSHLYTFGGCLRPTTTEEVPHPLQGP 37 >ref|XP_003546722.1| PREDICTED: putative phospholipid-transporting ATPase 4-like [Glycine max] Length = 1224 Score = 67.4 bits (163), Expect = 1e-09 Identities = 31/37 (83%), Positives = 34/37 (91%), Gaps = 1/37 (2%) Frame = +3 Query: 219 MTRGRIRAKLRRSNLYTFG-CLRPTTTEEAPHPLQGP 326 M RGRIRA++RRS+LYTFG CLRPTTTEE PHPLQGP Sbjct: 1 MARGRIRARIRRSHLYTFGGCLRPTTTEEVPHPLQGP 37 >ref|XP_003627157.1| Aminophospholipid ATPase [Medicago truncatula] gi|355521179|gb|AET01633.1| Aminophospholipid ATPase [Medicago truncatula] Length = 1208 Score = 62.8 bits (151), Expect = 3e-08 Identities = 29/37 (78%), Positives = 32/37 (86%), Gaps = 1/37 (2%) Frame = +3 Query: 219 MTRGRIRAKLRRSNLYTFGCLRPT-TTEEAPHPLQGP 326 M +GRIRA+LRRSN YTFGCLR + TTEE PHPLQGP Sbjct: 1 MAKGRIRARLRRSNFYTFGCLRASATTEEGPHPLQGP 37