BLASTX nr result
ID: Glycyrrhiza24_contig00021538
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza24_contig00021538 (362 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003525479.1| PREDICTED: LRR receptor-like serine/threonin... 78 8e-13 ref|XP_003608983.1| LRR receptor-like serine/threonine-protein k... 73 3e-11 ref|XP_003522344.1| PREDICTED: LOW QUALITY PROTEIN: LRR receptor... 65 7e-09 ref|XP_003527058.1| PREDICTED: LRR receptor-like serine/threonin... 61 1e-07 ref|XP_002511511.1| BRASSINOSTEROID INSENSITIVE 1-associated rec... 58 7e-07 >ref|XP_003525479.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase FEI 1-like [Glycine max] Length = 595 Score = 77.8 bits (190), Expect = 8e-13 Identities = 36/43 (83%), Positives = 39/43 (90%) Frame = -1 Query: 131 AWVFMVIFTTVFSPSSLALTQDGLALLEIKSTLNDTKNVLSNW 3 AW+F+VI T F PSSLALTQDG+ALLEIKSTLNDTKNVLSNW Sbjct: 5 AWIFLVIMVTFFCPSSLALTQDGMALLEIKSTLNDTKNVLSNW 47 >ref|XP_003608983.1| LRR receptor-like serine/threonine-protein kinase FEI [Medicago truncatula] gi|355510038|gb|AES91180.1| LRR receptor-like serine/threonine-protein kinase FEI [Medicago truncatula] Length = 605 Score = 72.8 bits (177), Expect = 3e-11 Identities = 34/46 (73%), Positives = 40/46 (86%) Frame = -1 Query: 140 TVAAWVFMVIFTTVFSPSSLALTQDGLALLEIKSTLNDTKNVLSNW 3 T+ A F+++FTT+F+ SSLALTQDG LLEIKSTLNDTKNVLSNW Sbjct: 4 TIVACTFLLVFTTLFNSSSLALTQDGQTLLEIKSTLNDTKNVLSNW 49 >ref|XP_003522344.1| PREDICTED: LOW QUALITY PROTEIN: LRR receptor-like serine/threonine-protein kinase FEI 1-like [Glycine max] Length = 594 Score = 64.7 bits (156), Expect = 7e-09 Identities = 32/45 (71%), Positives = 36/45 (80%) Frame = -1 Query: 137 VAAWVFMVIFTTVFSPSSLALTQDGLALLEIKSTLNDTKNVLSNW 3 V + +VI TTV PSSLALT DGLALLE+KSTLNDT+N LSNW Sbjct: 4 VVLMLMVVISTTVLCPSSLALTLDGLALLEVKSTLNDTRNFLSNW 48 >ref|XP_003527058.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase FEI 1-like [Glycine max] Length = 599 Score = 60.8 bits (146), Expect = 1e-07 Identities = 29/39 (74%), Positives = 33/39 (84%) Frame = -1 Query: 119 MVIFTTVFSPSSLALTQDGLALLEIKSTLNDTKNVLSNW 3 +VI + V PSSLALTQDGL LLE+KSTLNDT+N LSNW Sbjct: 10 VVISSIVLCPSSLALTQDGLTLLEVKSTLNDTRNFLSNW 48 >ref|XP_002511511.1| BRASSINOSTEROID INSENSITIVE 1-associated receptor kinase 1 precursor, putative [Ricinus communis] gi|223550626|gb|EEF52113.1| BRASSINOSTEROID INSENSITIVE 1-associated receptor kinase 1 precursor, putative [Ricinus communis] Length = 604 Score = 58.2 bits (139), Expect = 7e-07 Identities = 27/34 (79%), Positives = 31/34 (91%) Frame = -1 Query: 104 TVFSPSSLALTQDGLALLEIKSTLNDTKNVLSNW 3 T+FS SSLALT+DGL LLEIKSTLND++NVL NW Sbjct: 24 TLFSTSSLALTEDGLTLLEIKSTLNDSRNVLGNW 57