BLASTX nr result
ID: Glycyrrhiza24_contig00021510
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza24_contig00021510 (245 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|ZP_16593857.1| hypothetical protein HMPREF9574_00607 [Propio... 137 7e-31 ref|ZP_02043165.1| hypothetical protein ACTODO_00002 [Actinomyce... 134 8e-30 ref|ZP_06910887.1| conserved hypothetical protein [Streptomyces ... 130 1e-28 ref|ZP_06708712.1| conserved hypothetical protein [Streptomyces ... 130 1e-28 ref|ZP_05003849.1| conserved hypothetical protein [Streptomyces ... 130 1e-28 >ref|ZP_16593857.1| hypothetical protein HMPREF9574_00607 [Propionibacterium acnes HL074PA1] gi|313773062|gb|EFS39028.1| hypothetical protein HMPREF9574_00607 [Propionibacterium acnes HL074PA1] Length = 105 Score = 137 bits (346), Expect = 7e-31 Identities = 62/65 (95%), Positives = 63/65 (96%) Frame = -2 Query: 244 EGGDDVKSSCPLCPGLHACYNGWYREWRACEGERISESRSQFGLGSATRPHEVGIASNRG 65 EGGDDVKSSCPLCPGLHACYNGWYREWRACEGERISESRSQFGLGSATRPHEVG+ASNR Sbjct: 41 EGGDDVKSSCPLCPGLHACYNGWYREWRACEGERISESRSQFGLGSATRPHEVGVASNRR 100 Query: 64 SATPR 50 SAT R Sbjct: 101 SATLR 105 >ref|ZP_02043165.1| hypothetical protein ACTODO_00002 [Actinomyces odontolyticus ATCC 17982] gi|153799348|gb|EDN81768.1| hypothetical protein ACTODO_00002 [Actinomyces odontolyticus ATCC 17982] Length = 89 Score = 134 bits (337), Expect = 8e-30 Identities = 67/81 (82%), Positives = 69/81 (85%) Frame = -3 Query: 243 KVGMTSSHHAPYVQGFTHATMAGTESGEPVRVSESRKAGLSSDWGLQLDLMKSESLVIAD 64 KVGMTS+HHAPYV GFTHATMAGTE + VR SES KA LSSDWGLQLD MK ESLVIAD Sbjct: 8 KVGMTSNHHAPYVLGFTHATMAGTEGCDTVRWSESLKASLSSDWGLQLDPMKVESLVIAD 67 Query: 63 QQRRGEYVPGPCTHRPSSHES 1 QQR GEYV GPCTHRPS HES Sbjct: 68 QQRCGEYVLGPCTHRPSRHES 88 >ref|ZP_06910887.1| conserved hypothetical protein [Streptomyces pristinaespiralis ATCC 25486] gi|297151805|gb|EDY62143.2| conserved hypothetical protein [Streptomyces pristinaespiralis ATCC 25486] Length = 95 Score = 130 bits (327), Expect = 1e-28 Identities = 66/81 (81%), Positives = 68/81 (83%) Frame = -3 Query: 243 KVGMTSSHHAPYVQGFTHATMAGTESGEPVRVSESRKAGLSSDWGLQLDLMKSESLVIAD 64 KVG TSSHHAPYV G T ATMAGT+S E VR SES+KAGLSSDWGLQLD MKSE LVIAD Sbjct: 14 KVGTTSSHHAPYVLGCTRATMAGTKSCEAVRRSESQKAGLSSDWGLQLDPMKSELLVIAD 73 Query: 63 QQRRGEYVPGPCTHRPSSHES 1 Q GEYVPGPCTHRPS HES Sbjct: 74 QHCCGEYVPGPCTHRPSRHES 94 >ref|ZP_06708712.1| conserved hypothetical protein [Streptomyces sp. e14] gi|292833485|gb|EFF91834.1| conserved hypothetical protein [Streptomyces sp. e14] Length = 95 Score = 130 bits (327), Expect = 1e-28 Identities = 66/81 (81%), Positives = 68/81 (83%) Frame = -3 Query: 243 KVGMTSSHHAPYVQGFTHATMAGTESGEPVRVSESRKAGLSSDWGLQLDLMKSESLVIAD 64 KVG TSSHHAPYV G T ATMAGT S + VR SES+KAGLSSDWGLQLD MKSESLVIAD Sbjct: 14 KVGTTSSHHAPYVLGCTRATMAGTMSCDTVRWSESQKAGLSSDWGLQLDPMKSESLVIAD 73 Query: 63 QQRRGEYVPGPCTHRPSSHES 1 Q GEYVPGPCTHRPS HES Sbjct: 74 QHCCGEYVPGPCTHRPSRHES 94 >ref|ZP_05003849.1| conserved hypothetical protein [Streptomyces clavuligerus ATCC 27064] gi|197702336|gb|EDY48148.1| conserved hypothetical protein [Streptomyces clavuligerus ATCC 27064] Length = 95 Score = 130 bits (327), Expect = 1e-28 Identities = 66/81 (81%), Positives = 68/81 (83%) Frame = -3 Query: 243 KVGMTSSHHAPYVQGFTHATMAGTESGEPVRVSESRKAGLSSDWGLQLDLMKSESLVIAD 64 KVG TSSHHAPYV G T ATMAGT+S E VR SES+KAGLSSDWGLQLD MKSE LVIAD Sbjct: 14 KVGTTSSHHAPYVLGCTRATMAGTKSCETVRWSESQKAGLSSDWGLQLDPMKSELLVIAD 73 Query: 63 QQRRGEYVPGPCTHRPSSHES 1 Q GEYVPGPCTHRPS HES Sbjct: 74 QHCCGEYVPGPCTHRPSRHES 94