BLASTX nr result
ID: Glycyrrhiza24_contig00021268
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza24_contig00021268 (280 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAR78995.1| legumin storage protein 3 [Lotus japonicus] 60 2e-07 emb|CAR78992.1| legumin storage protein 3 [Lotus japonicus] 60 2e-07 emb|CAR78991.1| legumin storage protein 2 [Lotus japonicus] 60 2e-07 ref|NP_001238008.1| glycinin A5A4B3 precursor [Glycine max] gi|4... 59 5e-07 ref|NP_001235795.1| glycinin G4 precursor [Glycine max] gi|12127... 59 5e-07 >emb|CAR78995.1| legumin storage protein 3 [Lotus japonicus] Length = 498 Score = 60.1 bits (144), Expect = 2e-07 Identities = 27/30 (90%), Positives = 27/30 (90%) Frame = +2 Query: 191 NGLEETLCTLKIHENIARPSRADLYNPRAG 280 NGLEE CTLKIHENI RPSRADLYNPRAG Sbjct: 309 NGLEENFCTLKIHENINRPSRADLYNPRAG 338 >emb|CAR78992.1| legumin storage protein 3 [Lotus japonicus] Length = 614 Score = 60.1 bits (144), Expect = 2e-07 Identities = 27/30 (90%), Positives = 27/30 (90%) Frame = +2 Query: 191 NGLEETLCTLKIHENIARPSRADLYNPRAG 280 NGLEE CTLKIHENI RPSRADLYNPRAG Sbjct: 425 NGLEENFCTLKIHENINRPSRADLYNPRAG 454 >emb|CAR78991.1| legumin storage protein 2 [Lotus japonicus] Length = 583 Score = 60.1 bits (144), Expect = 2e-07 Identities = 27/30 (90%), Positives = 27/30 (90%) Frame = +2 Query: 191 NGLEETLCTLKIHENIARPSRADLYNPRAG 280 NGLEE CTLKIHENI RPSRADLYNPRAG Sbjct: 394 NGLEENFCTLKIHENINRPSRADLYNPRAG 423 >ref|NP_001238008.1| glycinin A5A4B3 precursor [Glycine max] gi|4249568|dbj|BAA74953.1| glycinin [Glycine max] gi|56201482|dbj|BAD72975.1| glycinin A5A4B3 [Glycine max] Length = 563 Score = 58.5 bits (140), Expect = 5e-07 Identities = 24/30 (80%), Positives = 28/30 (93%) Frame = +2 Query: 191 NGLEETLCTLKIHENIARPSRADLYNPRAG 280 NG+EE +CTLK+HENIARPSRAD YNP+AG Sbjct: 378 NGVEENICTLKLHENIARPSRADFYNPKAG 407 >ref|NP_001235795.1| glycinin G4 precursor [Glycine max] gi|121279|sp|P02858.1|GLYG4_SOYBN RecName: Full=Glycinin G4; Contains: RecName: Full=Glycinin A5 subunit; Contains: RecName: Full=Glycinin A4 subunit; Contains: RecName: Full=Glycinin B3 subunit; Flags: Precursor gi|732706|emb|CAA26478.1| unnamed protein product [Glycine max] Length = 562 Score = 58.5 bits (140), Expect = 5e-07 Identities = 24/30 (80%), Positives = 28/30 (93%) Frame = +2 Query: 191 NGLEETLCTLKIHENIARPSRADLYNPRAG 280 NG+EE +CTLK+HENIARPSRAD YNP+AG Sbjct: 377 NGVEENICTLKLHENIARPSRADFYNPKAG 406