BLASTX nr result
ID: Glycyrrhiza24_contig00021262
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza24_contig00021262 (332 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003536922.1| PREDICTED: lysine histidine transporter-like... 58 7e-07 ref|XP_003520188.1| PREDICTED: LOW QUALITY PROTEIN: amino acid p... 58 7e-07 ref|XP_002307630.1| proline transporter [Populus trichocarpa] gi... 56 3e-06 >ref|XP_003536922.1| PREDICTED: lysine histidine transporter-like 5-like [Glycine max] Length = 423 Score = 58.2 bits (139), Expect = 7e-07 Identities = 26/32 (81%), Positives = 28/32 (87%) Frame = -2 Query: 121 LHAVYKHYHRDGKLTLQHFIVFFGIFELLLVQ 26 L AVYKHYH +G LTLQHFI+FFGIFELLL Q Sbjct: 112 LKAVYKHYHENGTLTLQHFIIFFGIFELLLSQ 143 >ref|XP_003520188.1| PREDICTED: LOW QUALITY PROTEIN: amino acid permease 2-like [Glycine max] Length = 426 Score = 58.2 bits (139), Expect = 7e-07 Identities = 26/32 (81%), Positives = 28/32 (87%) Frame = -2 Query: 121 LHAVYKHYHRDGKLTLQHFIVFFGIFELLLVQ 26 L AVYKHYH +G LTLQHFI+FFGIFELLL Q Sbjct: 119 LKAVYKHYHENGALTLQHFIIFFGIFELLLSQ 150 >ref|XP_002307630.1| proline transporter [Populus trichocarpa] gi|222857079|gb|EEE94626.1| proline transporter [Populus trichocarpa] Length = 382 Score = 55.8 bits (133), Expect = 3e-06 Identities = 24/32 (75%), Positives = 27/32 (84%) Frame = -2 Query: 121 LHAVYKHYHRDGKLTLQHFIVFFGIFELLLVQ 26 L AVYKHYH++G LTLQHFI+FFG FEL L Q Sbjct: 72 LKAVYKHYHKEGTLTLQHFIIFFGAFELFLSQ 103