BLASTX nr result
ID: Glycyrrhiza24_contig00021128
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza24_contig00021128 (647 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003616146.1| hypothetical protein MTR_5g076600 [Medicago ... 103 4e-20 tpg|DAA40722.1| TPA: hypothetical protein ZEAMMB73_194935 [Zea m... 89 5e-16 ref|XP_003578613.1| PREDICTED: uncharacterized protein LOC100833... 77 4e-12 dbj|BAK05462.1| predicted protein [Hordeum vulgare subsp. vulgare] 74 2e-11 ref|XP_003564165.1| PREDICTED: uncharacterized protein LOC100843... 72 7e-11 >ref|XP_003616146.1| hypothetical protein MTR_5g076600 [Medicago truncatula] gi|355517481|gb|AES99104.1| hypothetical protein MTR_5g076600 [Medicago truncatula] Length = 119 Score = 103 bits (256), Expect = 4e-20 Identities = 50/58 (86%), Positives = 54/58 (93%) Frame = -1 Query: 539 IFGKHVFPGQIILFASGLLFLASTTYDVHRSIKNNQTPPSQEQLKALQDYINSVRRSP 366 IFGK VFP QIILFASGLLFLASTTYDVHRSIKNN+TPPS+EQLKAL++YI SVRR P Sbjct: 3 IFGKPVFPRQIILFASGLLFLASTTYDVHRSIKNNETPPSEEQLKALEEYIKSVRRQP 60 >tpg|DAA40722.1| TPA: hypothetical protein ZEAMMB73_194935 [Zea mays] Length = 750 Score = 89.4 bits (220), Expect = 5e-16 Identities = 38/53 (71%), Positives = 49/53 (92%) Frame = -1 Query: 539 IFGKHVFPGQIILFASGLLFLASTTYDVHRSIKNNQTPPSQEQLKALQDYINS 381 +FGKHVFP QI+LFA+G++F +TTYDVHRSIKNN+ PP++EQ++ALQDYINS Sbjct: 689 LFGKHVFPRQIVLFAAGMVFFGATTYDVHRSIKNNEQPPTREQMEALQDYINS 741 >ref|XP_003578613.1| PREDICTED: uncharacterized protein LOC100833743 [Brachypodium distachyon] Length = 58 Score = 76.6 bits (187), Expect = 4e-12 Identities = 34/56 (60%), Positives = 45/56 (80%) Frame = -1 Query: 539 IFGKHVFPGQIILFASGLLFLASTTYDVHRSIKNNQTPPSQEQLKALQDYINSVRR 372 + GKHV Q+ LFA+GL+F +TTYDVHRSIKNN PP++EQ++ALQ YI+S +R Sbjct: 3 LLGKHVSARQVALFAAGLVFFGATTYDVHRSIKNNDQPPTREQMEALQQYIDSKKR 58 >dbj|BAK05462.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 58 Score = 73.9 bits (180), Expect = 2e-11 Identities = 33/56 (58%), Positives = 44/56 (78%) Frame = -1 Query: 539 IFGKHVFPGQIILFASGLLFLASTTYDVHRSIKNNQTPPSQEQLKALQDYINSVRR 372 + G+HV P QI+L A+GL+F +TTYDVHRSIKNN PP+ EQ+ ALQ +I+S +R Sbjct: 3 LLGRHVSPRQIVLLAAGLVFFGATTYDVHRSIKNNDQPPTSEQVAALQAFIDSRKR 58 >ref|XP_003564165.1| PREDICTED: uncharacterized protein LOC100843543 [Brachypodium distachyon] Length = 83 Score = 72.4 bits (176), Expect = 7e-11 Identities = 32/48 (66%), Positives = 40/48 (83%) Frame = -1 Query: 533 GKHVFPGQIILFASGLLFLASTTYDVHRSIKNNQTPPSQEQLKALQDY 390 GKHV P Q+ LFA+GL+F +TTYDVHRSIKNN PP++EQ++ALQ Y Sbjct: 5 GKHVSPRQVALFAAGLVFFGATTYDVHRSIKNNDQPPTREQMEALQVY 52