BLASTX nr result
ID: Glycyrrhiza24_contig00021096
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza24_contig00021096 (330 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003527169.1| PREDICTED: probable GMP synthase [glutamine-... 64 1e-08 ref|XP_003610321.1| Methyladenine glycosylase protein-like prote... 63 2e-08 ref|XP_003549544.1| PREDICTED: probable GMP synthase [glutamine-... 55 8e-06 >ref|XP_003527169.1| PREDICTED: probable GMP synthase [glutamine-hydrolyzing]-like [Glycine max] Length = 383 Score = 63.9 bits (154), Expect = 1e-08 Identities = 31/32 (96%), Positives = 31/32 (96%) Frame = -2 Query: 98 SGAPRLRSMNVADSEARPVFGPAGNKTGSLSS 3 SGAPRLRSMNVADSEARPV GPAGNKTGSLSS Sbjct: 2 SGAPRLRSMNVADSEARPVLGPAGNKTGSLSS 33 >ref|XP_003610321.1| Methyladenine glycosylase protein-like protein [Medicago truncatula] gi|355511376|gb|AES92518.1| Methyladenine glycosylase protein-like protein [Medicago truncatula] Length = 375 Score = 63.2 bits (152), Expect = 2e-08 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = -2 Query: 101 SSGAPRLRSMNVADSEARPVFGPAGNKTGSLSS 3 +SG PRLRSMNVADSEARPVFGPAGNKTGS SS Sbjct: 3 ASGGPRLRSMNVADSEARPVFGPAGNKTGSYSS 35 >ref|XP_003549544.1| PREDICTED: probable GMP synthase [glutamine-hydrolyzing]-like [Glycine max] Length = 373 Score = 54.7 bits (130), Expect = 8e-06 Identities = 28/30 (93%), Positives = 28/30 (93%), Gaps = 1/30 (3%) Frame = -2 Query: 89 PRLRSMNVADSEA-RPVFGPAGNKTGSLSS 3 PRLRSMNV DSEA RPVFGPAGNKTGSLSS Sbjct: 4 PRLRSMNVGDSEAARPVFGPAGNKTGSLSS 33