BLASTX nr result
ID: Glycyrrhiza24_contig00021069
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza24_contig00021069 (359 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003549346.1| PREDICTED: fructan 6-exohydrolase-like [Glyc... 72 6e-11 >ref|XP_003549346.1| PREDICTED: fructan 6-exohydrolase-like [Glycine max] Length = 626 Score = 71.6 bits (174), Expect = 6e-11 Identities = 32/43 (74%), Positives = 34/43 (79%) Frame = +3 Query: 231 NLGAIIMETIANGASPYIINSNKYKVPGKQPYRPWYHFQPPQN 359 NLG IIME GASP+ INS K+KVP KQPYR WYHFQPPQN Sbjct: 59 NLGTIIMEINGEGASPHSINSIKFKVPEKQPYRTWYHFQPPQN 101