BLASTX nr result
ID: Glycyrrhiza24_contig00020869
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza24_contig00020869 (706 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003622806.1| hypothetical protein MTR_7g052660 [Medicago ... 58 2e-06 >ref|XP_003622806.1| hypothetical protein MTR_7g052660 [Medicago truncatula] gi|355497821|gb|AES79024.1| hypothetical protein MTR_7g052660 [Medicago truncatula] Length = 97 Score = 58.2 bits (139), Expect = 2e-06 Identities = 26/47 (55%), Positives = 29/47 (61%) Frame = -3 Query: 335 SVIKW*PWHRHGRFFANCHMQFVKGVPP*RRHRPQGCVYRVEFWPSA 195 SV+KW WHRHGR N FVKG PP RH+ Q VY +WPSA Sbjct: 22 SVVKWRSWHRHGRILYNGRSHFVKGCPPWWRHKLQWRVYIAVYWPSA 68