BLASTX nr result
ID: Glycyrrhiza24_contig00020802
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza24_contig00020802 (364 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAY27751.1| allene oxide synthase [Hevea brasiliensis] 70 2e-10 gb|ABC49700.1| latex allene oxide synthase [Hevea brasiliensis] 70 2e-10 ref|XP_002510320.1| cytochrome P450, putative [Ricinus communis]... 68 9e-10 emb|CBI19616.3| unnamed protein product [Vitis vinifera] 67 1e-09 ref|XP_002302453.1| cytochrome P450 allene oxide synthase [Popul... 67 1e-09 >gb|AAY27751.1| allene oxide synthase [Hevea brasiliensis] Length = 524 Score = 69.7 bits (169), Expect = 2e-10 Identities = 37/55 (67%), Positives = 39/55 (70%), Gaps = 10/55 (18%) Frame = +2 Query: 230 TPIKASVSE---------TAEPT-SRNLPIRKIPGDYGLPFIGPIQDRLDYFYNQ 364 +PIKASVSE T PT S LP+RKIPGDYGLPFIGPI DRLDYFY Q Sbjct: 32 SPIKASVSEKPSIGISSPTVSPTDSSKLPLRKIPGDYGLPFIGPINDRLDYFYKQ 86 >gb|ABC49700.1| latex allene oxide synthase [Hevea brasiliensis] Length = 524 Score = 69.7 bits (169), Expect = 2e-10 Identities = 37/55 (67%), Positives = 39/55 (70%), Gaps = 10/55 (18%) Frame = +2 Query: 230 TPIKASVSE---------TAEPT-SRNLPIRKIPGDYGLPFIGPIQDRLDYFYNQ 364 +PIKASVSE T PT S LP+RKIPGDYGLPFIGPI DRLDYFY Q Sbjct: 32 SPIKASVSEKPSIGISSPTVSPTDSSKLPLRKIPGDYGLPFIGPINDRLDYFYKQ 86 >ref|XP_002510320.1| cytochrome P450, putative [Ricinus communis] gi|223551021|gb|EEF52507.1| cytochrome P450, putative [Ricinus communis] Length = 518 Score = 67.8 bits (164), Expect = 9e-10 Identities = 35/55 (63%), Positives = 37/55 (67%), Gaps = 10/55 (18%) Frame = +2 Query: 230 TPIKASVSETAEPT----------SRNLPIRKIPGDYGLPFIGPIQDRLDYFYNQ 364 +PI ASVSE T S LPIRKIPGDYGLPF GPI+DRLDYFYNQ Sbjct: 28 SPITASVSEKPSTTNSPLIVSPTESSKLPIRKIPGDYGLPFFGPIKDRLDYFYNQ 82 >emb|CBI19616.3| unnamed protein product [Vitis vinifera] Length = 473 Score = 67.4 bits (163), Expect = 1e-09 Identities = 42/75 (56%), Positives = 48/75 (64%), Gaps = 9/75 (12%) Frame = +2 Query: 167 QLEFP---QKRTPCNCKRSMCRLSTPIKASVSETAE-PTSRNL-----PIRKIPGDYGLP 319 QL+FP + P N K + PI ASVSE P S++ PIRKIPGDYGLP Sbjct: 12 QLQFPTHTKSSKPSNHKL----IVRPIFASVSEKPSVPVSQSQVTPPGPIRKIPGDYGLP 67 Query: 320 FIGPIQDRLDYFYNQ 364 FIGPI+DRLDYFYNQ Sbjct: 68 FIGPIKDRLDYFYNQ 82 >ref|XP_002302453.1| cytochrome P450 allene oxide synthase [Populus trichocarpa] gi|222844179|gb|EEE81726.1| cytochrome P450 allene oxide synthase [Populus trichocarpa] Length = 526 Score = 67.4 bits (163), Expect = 1e-09 Identities = 39/79 (49%), Positives = 48/79 (60%), Gaps = 13/79 (16%) Frame = +2 Query: 167 QLEFPQKRTPCNCKRSMCRLST-PIKASVSET------------AEPTSRNLPIRKIPGD 307 Q +F + P + K S R S PI+AS+SE +EPT LPIRKIPGD Sbjct: 12 QTQFQSLKKPSSPKPSTRRFSVRPIRASISEKPSVPGPPATVSPSEPTK--LPIRKIPGD 69 Query: 308 YGLPFIGPIQDRLDYFYNQ 364 +GLP IGP +DR+DYFYNQ Sbjct: 70 HGLPLIGPFKDRMDYFYNQ 88