BLASTX nr result
ID: Glycyrrhiza24_contig00020708
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza24_contig00020708 (312 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003548595.1| PREDICTED: LRR receptor-like serine/threonin... 65 4e-09 ref|XP_003516786.1| PREDICTED: receptor-like protein kinase HSL1... 54 1e-05 >ref|XP_003548595.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase HSL2-like [Glycine max] Length = 1011 Score = 65.5 bits (158), Expect = 4e-09 Identities = 32/46 (69%), Positives = 36/46 (78%), Gaps = 2/46 (4%) Frame = -2 Query: 311 ATLPSSRPSMKEAVHILLRCEEGFVLGQRNVD--DVVPLLKNSKWE 180 +TLP+ RPSMKE +HILLRC EGF G+ NV D VPLLKNSKWE Sbjct: 953 STLPAKRPSMKEVLHILLRCGEGFAFGEGNVRQYDGVPLLKNSKWE 998 >ref|XP_003516786.1| PREDICTED: receptor-like protein kinase HSL1-like [Glycine max] Length = 1003 Score = 54.3 bits (129), Expect = 1e-05 Identities = 27/46 (58%), Positives = 32/46 (69%), Gaps = 2/46 (4%) Frame = -2 Query: 311 ATLPSSRPSMKEAVHILLRCEEGFVLGQRNVD--DVVPLLKNSKWE 180 ATLP+SRPSMKE + ILL C G++N D +PLLKNSKWE Sbjct: 948 ATLPASRPSMKEVLKILLTCSNLLTNGEKNAGFYDSIPLLKNSKWE 993