BLASTX nr result
ID: Glycyrrhiza24_contig00020405
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza24_contig00020405 (675 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003622856.1| hypothetical protein MTR_7g055560 [Medicago ... 99 1e-18 ref|XP_003551351.1| PREDICTED: uncharacterized protein LOC100803... 91 2e-16 >ref|XP_003622856.1| hypothetical protein MTR_7g055560 [Medicago truncatula] gi|355497871|gb|AES79074.1| hypothetical protein MTR_7g055560 [Medicago truncatula] Length = 429 Score = 98.6 bits (244), Expect = 1e-18 Identities = 55/85 (64%), Positives = 62/85 (72%), Gaps = 2/85 (2%) Frame = -1 Query: 249 VHEKGVVVGSELLPTES--SKWGFFLSVLQTFLAWVVSESDDKDEEIGFLDELEAYLVMF 76 VH KG + ES SKW FFLS+LQTFLAW E+DDKDEEIG L+ELEAYLVMF Sbjct: 78 VHHKGSSKSTSTSSVESYESKWCFFLSILQTFLAWF--EADDKDEEIGLLNELEAYLVMF 135 Query: 75 QASIFEALEPKSLEDCSEERFEAED 1 QASIFE EPKS+ED EE EA++ Sbjct: 136 QASIFEVHEPKSVEDFVEEFEEADE 160 >ref|XP_003551351.1| PREDICTED: uncharacterized protein LOC100803584 [Glycine max] Length = 513 Score = 91.3 bits (225), Expect = 2e-16 Identities = 49/75 (65%), Positives = 61/75 (81%) Frame = -1 Query: 225 GSELLPTESSKWGFFLSVLQTFLAWVVSESDDKDEEIGFLDELEAYLVMFQASIFEALEP 46 GSE P+ES KWG LSV+++FLAW+ S++D+ DEE+G L E+EAYLVMFQASIFE EP Sbjct: 83 GSE--PSES-KWGIVLSVMKSFLAWLHSKADEIDEEMGLLGEVEAYLVMFQASIFEVFEP 139 Query: 45 KSLEDCSEERFEAED 1 KS+E+CS E FEA D Sbjct: 140 KSVEECS-EGFEAVD 153