BLASTX nr result
ID: Glycyrrhiza24_contig00020279
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza24_contig00020279 (291 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003591369.1| Annotation was added to scaffolds in Novembe... 103 1e-20 ref|XP_003591368.1| Annotation was added to scaffolds in Novembe... 103 1e-20 ref|XP_003591367.1| Annotation was added to scaffolds in Novembe... 103 1e-20 ref|XP_003535896.1| PREDICTED: long chain acyl-CoA synthetase 1-... 99 5e-19 ref|XP_003518711.1| PREDICTED: long chain acyl-CoA synthetase 1-... 99 5e-19 >ref|XP_003591369.1| Annotation was added to scaffolds in November 2011~Long chain fatty acid-CoA ligase [Medicago truncatula] gi|355480417|gb|AES61620.1| Annotation was added to scaffolds in November 2011~Long chain fatty acid-CoA ligase [Medicago truncatula] Length = 407 Score = 103 bits (258), Expect = 1e-20 Identities = 46/59 (77%), Positives = 53/59 (89%) Frame = -2 Query: 179 QRRMKMFAAKVEEGREGRNGMPSVGPVYRNLLSQKEFPPLDPEFSTAWDIFSVSVKNHP 3 QRRMK F+ KVEEG+EG+NGM SVGPVYRNLLSQ EFPP+DP+F++AWDIFS SVK HP Sbjct: 20 QRRMKSFSVKVEEGKEGKNGMLSVGPVYRNLLSQNEFPPMDPDFTSAWDIFSTSVKKHP 78 >ref|XP_003591368.1| Annotation was added to scaffolds in November 2011~Long chain fatty acid-CoA ligase [Medicago truncatula] gi|355480416|gb|AES61619.1| Annotation was added to scaffolds in November 2011~Long chain fatty acid-CoA ligase [Medicago truncatula] Length = 442 Score = 103 bits (258), Expect = 1e-20 Identities = 46/59 (77%), Positives = 53/59 (89%) Frame = -2 Query: 179 QRRMKMFAAKVEEGREGRNGMPSVGPVYRNLLSQKEFPPLDPEFSTAWDIFSVSVKNHP 3 QRRMK F+ KVEEG+EG+NGM SVGPVYRNLLSQ EFPP+DP+F++AWDIFS SVK HP Sbjct: 20 QRRMKSFSVKVEEGKEGKNGMLSVGPVYRNLLSQNEFPPMDPDFTSAWDIFSTSVKKHP 78 >ref|XP_003591367.1| Annotation was added to scaffolds in November 2011~Long chain fatty acid-CoA ligase [Medicago truncatula] gi|355480415|gb|AES61618.1| Annotation was added to scaffolds in November 2011~Long chain fatty acid-CoA ligase [Medicago truncatula] Length = 686 Score = 103 bits (258), Expect = 1e-20 Identities = 46/59 (77%), Positives = 53/59 (89%) Frame = -2 Query: 179 QRRMKMFAAKVEEGREGRNGMPSVGPVYRNLLSQKEFPPLDPEFSTAWDIFSVSVKNHP 3 QRRMK F+ KVEEG+EG+NGM SVGPVYRNLLSQ EFPP+DP+F++AWDIFS SVK HP Sbjct: 20 QRRMKSFSVKVEEGKEGKNGMLSVGPVYRNLLSQNEFPPMDPDFTSAWDIFSTSVKKHP 78 >ref|XP_003535896.1| PREDICTED: long chain acyl-CoA synthetase 1-like [Glycine max] Length = 660 Score = 98.6 bits (244), Expect = 5e-19 Identities = 44/56 (78%), Positives = 49/56 (87%) Frame = -2 Query: 170 MKMFAAKVEEGREGRNGMPSVGPVYRNLLSQKEFPPLDPEFSTAWDIFSVSVKNHP 3 MK F+ KVEEGREG+NG SVGPVYRNLLS+ EFPP+DP+FST WDIF VSVKNHP Sbjct: 1 MKAFSVKVEEGREGKNGNLSVGPVYRNLLSENEFPPMDPDFSTTWDIFCVSVKNHP 56 >ref|XP_003518711.1| PREDICTED: long chain acyl-CoA synthetase 1-like [Glycine max] Length = 660 Score = 98.6 bits (244), Expect = 5e-19 Identities = 44/56 (78%), Positives = 49/56 (87%) Frame = -2 Query: 170 MKMFAAKVEEGREGRNGMPSVGPVYRNLLSQKEFPPLDPEFSTAWDIFSVSVKNHP 3 MK F+ KVEEGREG+NG SVGPVYRNLLS+ EFPP+DP+FST WDIF VSVKNHP Sbjct: 1 MKAFSVKVEEGREGKNGNLSVGPVYRNLLSENEFPPMDPDFSTTWDIFCVSVKNHP 56