BLASTX nr result
ID: Glycyrrhiza24_contig00019695
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza24_contig00019695 (285 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003521431.1| PREDICTED: F-box protein PP2-A15-like [Glyci... 126 2e-27 gb|AFK35960.1| unknown [Medicago truncatula] 125 4e-27 gb|ACJ84444.1| unknown [Medicago truncatula] 125 4e-27 ref|XP_004137863.1| PREDICTED: F-box protein PP2-A15-like [Cucum... 121 5e-26 ref|XP_002283923.1| PREDICTED: F-box protein PP2-A15 [Vitis vini... 115 5e-24 >ref|XP_003521431.1| PREDICTED: F-box protein PP2-A15-like [Glycine max] Length = 295 Score = 126 bits (316), Expect = 2e-27 Identities = 60/66 (90%), Positives = 62/66 (93%) Frame = +3 Query: 87 MGASLSSLGTNGSTIGPGLGDIPENCVARVFLHLTPPEICNLARLNRAFRGAASADSVWQ 266 MGASLS+LG+NGS PGLGDIPENCVARVFLHLTPPEICNLARLNRAFRGAASADSVWQ Sbjct: 1 MGASLSNLGSNGSAAAPGLGDIPENCVARVFLHLTPPEICNLARLNRAFRGAASADSVWQ 60 Query: 267 TKLPPN 284 TKLP N Sbjct: 61 TKLPRN 66 >gb|AFK35960.1| unknown [Medicago truncatula] Length = 296 Score = 125 bits (314), Expect = 4e-27 Identities = 59/66 (89%), Positives = 63/66 (95%) Frame = +3 Query: 87 MGASLSSLGTNGSTIGPGLGDIPENCVARVFLHLTPPEICNLARLNRAFRGAASADSVWQ 266 MGASLS+LG+NGSTI P LGDIPENCVARVFLHLTPPEICNLARLNRAFRGAASADSVW+ Sbjct: 1 MGASLSNLGSNGSTIAPSLGDIPENCVARVFLHLTPPEICNLARLNRAFRGAASADSVWE 60 Query: 267 TKLPPN 284 +KLP N Sbjct: 61 SKLPSN 66 >gb|ACJ84444.1| unknown [Medicago truncatula] Length = 162 Score = 125 bits (314), Expect = 4e-27 Identities = 59/66 (89%), Positives = 63/66 (95%) Frame = +3 Query: 87 MGASLSSLGTNGSTIGPGLGDIPENCVARVFLHLTPPEICNLARLNRAFRGAASADSVWQ 266 MGASLS+LG+NGSTI P LGDIPENCVARVFLHLTPPEICNLARLNRAFRGAASADSVW+ Sbjct: 1 MGASLSNLGSNGSTIAPSLGDIPENCVARVFLHLTPPEICNLARLNRAFRGAASADSVWE 60 Query: 267 TKLPPN 284 +KLP N Sbjct: 61 SKLPSN 66 >ref|XP_004137863.1| PREDICTED: F-box protein PP2-A15-like [Cucumis sativus] gi|449521339|ref|XP_004167687.1| PREDICTED: F-box protein PP2-A15-like [Cucumis sativus] Length = 292 Score = 121 bits (304), Expect = 5e-26 Identities = 58/68 (85%), Positives = 64/68 (94%), Gaps = 2/68 (2%) Frame = +3 Query: 87 MGASLSSLG--TNGSTIGPGLGDIPENCVARVFLHLTPPEICNLARLNRAFRGAASADSV 260 MGASLS++G NGSTIGPGLGDIPENCVARVFLHLTPPEICNLARLNRAFRGAAS+D+V Sbjct: 1 MGASLSNMGEAVNGSTIGPGLGDIPENCVARVFLHLTPPEICNLARLNRAFRGAASSDAV 60 Query: 261 WQTKLPPN 284 W++KLP N Sbjct: 61 WESKLPSN 68 >ref|XP_002283923.1| PREDICTED: F-box protein PP2-A15 [Vitis vinifera] gi|147860674|emb|CAN81450.1| hypothetical protein VITISV_025851 [Vitis vinifera] gi|297740037|emb|CBI30219.3| unnamed protein product [Vitis vinifera] Length = 299 Score = 115 bits (287), Expect = 5e-24 Identities = 56/68 (82%), Positives = 63/68 (92%), Gaps = 2/68 (2%) Frame = +3 Query: 87 MGASLSSL--GTNGSTIGPGLGDIPENCVARVFLHLTPPEICNLARLNRAFRGAASADSV 260 MGA+LS+L G NGSTIGPGLGDIPE+CVA VFL+LTPPEICNLARLNRAFRGAAS+DSV Sbjct: 1 MGAALSNLTEGANGSTIGPGLGDIPESCVACVFLYLTPPEICNLARLNRAFRGAASSDSV 60 Query: 261 WQTKLPPN 284 W++KLP N Sbjct: 61 WESKLPSN 68