BLASTX nr result
ID: Glycyrrhiza24_contig00019686
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza24_contig00019686 (209 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003626568.1| Cyclic nucleotide-gated channel C [Medicago ... 119 2e-25 ref|XP_003529892.1| PREDICTED: putative cyclic nucleotide-gated ... 116 2e-24 ref|XP_003548420.1| PREDICTED: cyclic nucleotide-gated ion chann... 108 4e-22 ref|XP_003553784.1| PREDICTED: cyclic nucleotide-gated ion chann... 107 1e-21 ref|XP_002513573.1| Cyclic nucleotide-gated ion channel, putativ... 105 3e-21 >ref|XP_003626568.1| Cyclic nucleotide-gated channel C [Medicago truncatula] gi|355501583|gb|AES82786.1| Cyclic nucleotide-gated channel C [Medicago truncatula] Length = 718 Score = 119 bits (299), Expect = 2e-25 Identities = 57/69 (82%), Positives = 60/69 (86%) Frame = +1 Query: 1 VEAFALMPGDLKFVASQFRRLINHTQLQHTFRFYAPQWKTWAACFIQASWRRYRKKKIER 180 VEAFAL DLKFVASQFRRLIN QLQHTFR Y+PQWKTW ACFIQA+WRRY KKKIER Sbjct: 588 VEAFALKADDLKFVASQFRRLINSKQLQHTFRSYSPQWKTWGACFIQAAWRRYCKKKIER 647 Query: 181 SLHEAEDKL 207 +L EAEDKL Sbjct: 648 TLREAEDKL 656 >ref|XP_003529892.1| PREDICTED: putative cyclic nucleotide-gated ion channel 13-like [Glycine max] Length = 689 Score = 116 bits (291), Expect = 2e-24 Identities = 54/69 (78%), Positives = 60/69 (86%) Frame = +1 Query: 1 VEAFALMPGDLKFVASQFRRLINHTQLQHTFRFYAPQWKTWAACFIQASWRRYRKKKIER 180 VEAFALMP DLK VASQFRRLIN QLQHTFRFY+ QWKTW ACFIQA+WRRY+KKK ER Sbjct: 563 VEAFALMPDDLKCVASQFRRLINSKQLQHTFRFYSLQWKTWGACFIQAAWRRYKKKKAER 622 Query: 181 SLHEAEDKL 207 L EAE+++ Sbjct: 623 LLREAEERI 631 >ref|XP_003548420.1| PREDICTED: cyclic nucleotide-gated ion channel 1-like [Glycine max] Length = 686 Score = 108 bits (270), Expect = 4e-22 Identities = 49/69 (71%), Positives = 57/69 (82%) Frame = +1 Query: 1 VEAFALMPGDLKFVASQFRRLINHTQLQHTFRFYAPQWKTWAACFIQASWRRYRKKKIER 180 VEAFALM DL FVASQFRRL+N QLQHTFRFY+ QWKTW ACFIQA+W RY+KKK E+ Sbjct: 549 VEAFALMSDDLMFVASQFRRLLNSKQLQHTFRFYSLQWKTWGACFIQAAWHRYKKKKAEK 608 Query: 181 SLHEAEDKL 207 EAE+++ Sbjct: 609 LAREAEERI 617 >ref|XP_003553784.1| PREDICTED: cyclic nucleotide-gated ion channel 1-like [Glycine max] Length = 716 Score = 107 bits (266), Expect = 1e-21 Identities = 54/69 (78%), Positives = 58/69 (84%) Frame = +1 Query: 1 VEAFALMPGDLKFVASQFRRLINHTQLQHTFRFYAPQWKTWAACFIQASWRRYRKKKIER 180 VEAFAL DLKFVASQFRRL + QLQH FRFY+ QWKTWAA FIQA+WRRY KKKIER Sbjct: 587 VEAFALTADDLKFVASQFRRL-HSKQLQHAFRFYSSQWKTWAATFIQAAWRRYWKKKIER 645 Query: 181 SLHEAEDKL 207 SL EAED+L Sbjct: 646 SLREAEDEL 654 >ref|XP_002513573.1| Cyclic nucleotide-gated ion channel, putative [Ricinus communis] gi|223547481|gb|EEF48976.1| Cyclic nucleotide-gated ion channel, putative [Ricinus communis] Length = 838 Score = 105 bits (263), Expect = 3e-21 Identities = 50/69 (72%), Positives = 59/69 (85%) Frame = +1 Query: 1 VEAFALMPGDLKFVASQFRRLINHTQLQHTFRFYAPQWKTWAACFIQASWRRYRKKKIER 180 VEAFALM DLKFVASQFRRL + QL+HTFRFY+ QW+TWAACFIQA+WRRY KKK+E Sbjct: 583 VEAFALMADDLKFVASQFRRL-HSKQLRHTFRFYSQQWRTWAACFIQAAWRRYSKKKLEE 641 Query: 181 SLHEAEDKL 207 SL + E++L Sbjct: 642 SLRQEENRL 650