BLASTX nr result
ID: Glycyrrhiza24_contig00019479
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza24_contig00019479 (504 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002278909.1| PREDICTED: pentatricopeptide repeat-containi... 38 3e-06 >ref|XP_002278909.1| PREDICTED: pentatricopeptide repeat-containing protein At1g06270 [Vitis vinifera] gi|302143379|emb|CBI21940.3| unnamed protein product [Vitis vinifera] Length = 343 Score = 37.7 bits (86), Expect(3) = 3e-06 Identities = 18/32 (56%), Positives = 23/32 (71%) Frame = +1 Query: 205 GLVIFLLSSLCTIDQLVDAVKVLKSMGRAALV 300 G +L+ SLC IDQLV+AV VLKSMG+ + Sbjct: 172 GTCNYLILSLCAIDQLVEAVIVLKSMGQVGCI 203 Score = 35.4 bits (80), Expect(3) = 3e-06 Identities = 21/32 (65%), Positives = 23/32 (71%) Frame = +2 Query: 32 FLVPSKAPIPSLALAILQWILRSG*IIVPQTH 127 F + S P+P LALAILQ LRSG I VPQTH Sbjct: 108 FTLQSANPLP-LALAILQRTLRSGCIPVPQTH 138 Score = 21.6 bits (44), Expect(3) = 3e-06 Identities = 6/7 (85%), Positives = 7/7 (100%) Frame = +3 Query: 198 DCGTCNF 218 DCGTCN+ Sbjct: 170 DCGTCNY 176