BLASTX nr result
ID: Glycyrrhiza24_contig00019477
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza24_contig00019477 (312 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003601356.1| hypothetical protein MTR_3g079820 [Medicago ... 59 5e-07 ref|XP_002527563.1| conserved hypothetical protein [Ricinus comm... 59 5e-07 ref|NP_001238276.1| uncharacterized protein LOC100305889 [Glycin... 58 7e-07 ref|NP_568406.1| uncharacterized protein [Arabidopsis thaliana] ... 57 1e-06 ref|XP_002871962.1| hypothetical protein ARALYDRAFT_489002 [Arab... 57 1e-06 >ref|XP_003601356.1| hypothetical protein MTR_3g079820 [Medicago truncatula] gi|355490404|gb|AES71607.1| hypothetical protein MTR_3g079820 [Medicago truncatula] Length = 128 Score = 58.5 bits (140), Expect = 5e-07 Identities = 28/32 (87%), Positives = 29/32 (90%) Frame = +2 Query: 2 NSGLVKPGDVGRIVSRKPKVVWAVRLNIRAYL 97 NSGLVKPGDVGRIVSRKPK VWAVRL+I YL Sbjct: 82 NSGLVKPGDVGRIVSRKPKDVWAVRLSIGTYL 113 >ref|XP_002527563.1| conserved hypothetical protein [Ricinus communis] gi|223533055|gb|EEF34815.1| conserved hypothetical protein [Ricinus communis] Length = 128 Score = 58.5 bits (140), Expect = 5e-07 Identities = 28/32 (87%), Positives = 29/32 (90%) Frame = +2 Query: 2 NSGLVKPGDVGRIVSRKPKVVWAVRLNIRAYL 97 NSGLVKPGDVGRIVSRKPK VWAVRL+I YL Sbjct: 84 NSGLVKPGDVGRIVSRKPKDVWAVRLSIGTYL 115 >ref|NP_001238276.1| uncharacterized protein LOC100305889 [Glycine max] gi|255626895|gb|ACU13792.1| unknown [Glycine max] Length = 128 Score = 58.2 bits (139), Expect = 7e-07 Identities = 28/32 (87%), Positives = 28/32 (87%) Frame = +2 Query: 2 NSGLVKPGDVGRIVSRKPKVVWAVRLNIRAYL 97 NSGLVKPGDVGRIVSRKPK VWAVRL I YL Sbjct: 82 NSGLVKPGDVGRIVSRKPKDVWAVRLRIGTYL 113 >ref|NP_568406.1| uncharacterized protein [Arabidopsis thaliana] gi|332005525|gb|AED92908.1| uncharacterized protein [Arabidopsis thaliana] Length = 108 Score = 57.4 bits (137), Expect = 1e-06 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = +2 Query: 2 NSGLVKPGDVGRIVSRKPKVVWAVRLNIRAYL 97 NSGLVKPGDVGRIVSRKPK +WAVRL+I YL Sbjct: 60 NSGLVKPGDVGRIVSRKPKDLWAVRLSIGTYL 91 >ref|XP_002871962.1| hypothetical protein ARALYDRAFT_489002 [Arabidopsis lyrata subsp. lyrata] gi|297317799|gb|EFH48221.1| hypothetical protein ARALYDRAFT_489002 [Arabidopsis lyrata subsp. lyrata] Length = 108 Score = 57.4 bits (137), Expect = 1e-06 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = +2 Query: 2 NSGLVKPGDVGRIVSRKPKVVWAVRLNIRAYL 97 NSGLVKPGDVGRIVSRKPK +WAVRL+I YL Sbjct: 60 NSGLVKPGDVGRIVSRKPKDLWAVRLSIGTYL 91