BLASTX nr result
ID: Glycyrrhiza24_contig00019454
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza24_contig00019454 (257 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003544692.1| PREDICTED: BTB/POZ domain-containing protein... 103 2e-20 ref|XP_003543811.1| PREDICTED: BTB/POZ domain-containing protein... 100 1e-19 gb|AFK46355.1| unknown [Lotus japonicus] 99 3e-19 ref|XP_002285860.1| PREDICTED: BTB/POZ domain-containing protein... 99 4e-19 ref|XP_002513752.1| protein with unknown function [Ricinus commu... 99 5e-19 >ref|XP_003544692.1| PREDICTED: BTB/POZ domain-containing protein At1g21780-like [Glycine max] Length = 324 Score = 103 bits (256), Expect = 2e-20 Identities = 45/48 (93%), Positives = 47/48 (97%) Frame = +3 Query: 114 MGDSKVETIARLAQWKIDNFGPCSYKKSDPFKLGIWNWYLSIERNRYL 257 M DSKVETIARLAQWKIDNFGPCSYKKSDPFKLGIWNW++SIERNRYL Sbjct: 1 MSDSKVETIARLAQWKIDNFGPCSYKKSDPFKLGIWNWFMSIERNRYL 48 >ref|XP_003543811.1| PREDICTED: BTB/POZ domain-containing protein At1g21780-like [Glycine max] Length = 324 Score = 100 bits (249), Expect = 1e-19 Identities = 43/48 (89%), Positives = 47/48 (97%) Frame = +3 Query: 114 MGDSKVETIARLAQWKIDNFGPCSYKKSDPFKLGIWNWYLSIERNRYL 257 M DSKVETIARLAQWKIDNFGPCS+K+SDPFKLGIWNW++SIERNRYL Sbjct: 1 MSDSKVETIARLAQWKIDNFGPCSFKRSDPFKLGIWNWFMSIERNRYL 48 >gb|AFK46355.1| unknown [Lotus japonicus] Length = 327 Score = 99.4 bits (246), Expect = 3e-19 Identities = 42/48 (87%), Positives = 47/48 (97%) Frame = +3 Query: 114 MGDSKVETIARLAQWKIDNFGPCSYKKSDPFKLGIWNWYLSIERNRYL 257 M DSKVETI+RLAQW+I+NFGPCSYKKS+PFKLGIWNWY+SIERNRYL Sbjct: 1 MADSKVETISRLAQWRIENFGPCSYKKSEPFKLGIWNWYMSIERNRYL 48 >ref|XP_002285860.1| PREDICTED: BTB/POZ domain-containing protein At1g21780 [Vitis vinifera] gi|302141809|emb|CBI19012.3| unnamed protein product [Vitis vinifera] Length = 326 Score = 99.0 bits (245), Expect = 4e-19 Identities = 41/48 (85%), Positives = 48/48 (100%) Frame = +3 Query: 114 MGDSKVETIARLAQWKIDNFGPCSYKKSDPFKLGIWNWYLSIERNRYL 257 MGDSKVETI+RLAQW+IDNFGPCS+KKSDPFK+GIWNW+LSIE+NRY+ Sbjct: 1 MGDSKVETISRLAQWRIDNFGPCSFKKSDPFKVGIWNWHLSIEKNRYM 48 >ref|XP_002513752.1| protein with unknown function [Ricinus communis] gi|223546838|gb|EEF48335.1| protein with unknown function [Ricinus communis] Length = 326 Score = 98.6 bits (244), Expect = 5e-19 Identities = 41/48 (85%), Positives = 47/48 (97%) Frame = +3 Query: 114 MGDSKVETIARLAQWKIDNFGPCSYKKSDPFKLGIWNWYLSIERNRYL 257 M DSKVETI+RLAQW+IDNFGPCSYKKSDPFK+GIWNW+LS+E+NRYL Sbjct: 1 MADSKVETISRLAQWRIDNFGPCSYKKSDPFKVGIWNWHLSVEKNRYL 48