BLASTX nr result
ID: Glycyrrhiza24_contig00019217
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza24_contig00019217 (222 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003543883.1| PREDICTED: probable mitochondrial saccharopi... 67 2e-09 gb|AFK40865.1| unknown [Lotus japonicus] 65 4e-09 ref|XP_003621322.1| hypothetical protein MTR_7g011890 [Medicago ... 65 8e-09 ref|XP_003530420.1| PREDICTED: probable mitochondrial saccharopi... 64 1e-08 ref|XP_002532900.1| conserved hypothetical protein [Ricinus comm... 58 9e-07 >ref|XP_003543883.1| PREDICTED: probable mitochondrial saccharopine dehydrogenase At5g39410-like [Glycine max] Length = 444 Score = 67.0 bits (162), Expect = 2e-09 Identities = 32/36 (88%), Positives = 34/36 (94%) Frame = +3 Query: 3 GGVYTPAIVFGATDLQERLQQNGISFDVISKSTLSS 110 GGVYTP IVFG TDLQERLQQNGISFDVISKS++SS Sbjct: 409 GGVYTPGIVFGPTDLQERLQQNGISFDVISKSSISS 444 >gb|AFK40865.1| unknown [Lotus japonicus] Length = 282 Score = 65.5 bits (158), Expect = 4e-09 Identities = 31/36 (86%), Positives = 33/36 (91%) Frame = +3 Query: 3 GGVYTPAIVFGATDLQERLQQNGISFDVISKSTLSS 110 GGVY P I+FG TDLQ+RLQQNGISFDVISKSTLSS Sbjct: 247 GGVYPPGIIFGPTDLQQRLQQNGISFDVISKSTLSS 282 >ref|XP_003621322.1| hypothetical protein MTR_7g011890 [Medicago truncatula] gi|355496337|gb|AES77540.1| hypothetical protein MTR_7g011890 [Medicago truncatula] Length = 450 Score = 64.7 bits (156), Expect = 8e-09 Identities = 31/36 (86%), Positives = 33/36 (91%) Frame = +3 Query: 3 GGVYTPAIVFGATDLQERLQQNGISFDVISKSTLSS 110 GGVY P IVFG TDLQ+RLQQNGISFDVISKST+SS Sbjct: 415 GGVYPPGIVFGHTDLQQRLQQNGISFDVISKSTISS 450 >ref|XP_003530420.1| PREDICTED: probable mitochondrial saccharopine dehydrogenase At5g39410-like [Glycine max] Length = 451 Score = 64.3 bits (155), Expect = 1e-08 Identities = 30/35 (85%), Positives = 32/35 (91%) Frame = +3 Query: 3 GGVYTPAIVFGATDLQERLQQNGISFDVISKSTLS 107 GGVY P I+FG TDLQERLQQNGISFDVISKST+S Sbjct: 417 GGVYPPGIIFGPTDLQERLQQNGISFDVISKSTIS 451 >ref|XP_002532900.1| conserved hypothetical protein [Ricinus communis] gi|223527334|gb|EEF29480.1| conserved hypothetical protein [Ricinus communis] Length = 457 Score = 57.8 bits (138), Expect = 9e-07 Identities = 28/37 (75%), Positives = 30/37 (81%) Frame = +3 Query: 3 GGVYTPAIVFGATDLQERLQQNGISFDVISKSTLSSS 113 GGV+ P IVFG TDLQERLQ+NGISFD ISK L SS Sbjct: 418 GGVFPPGIVFGPTDLQERLQRNGISFDFISKRALPSS 454