BLASTX nr result
ID: Glycyrrhiza24_contig00019204
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza24_contig00019204 (300 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003554948.1| PREDICTED: sodium-coupled neutral amino acid... 74 9e-12 ref|XP_002534057.1| amino acid transporter, putative [Ricinus co... 72 6e-11 ref|XP_002329300.1| amino acid transporter [Populus trichocarpa]... 70 2e-10 ref|XP_003531894.1| PREDICTED: sodium-coupled neutral amino acid... 69 5e-10 ref|XP_002331285.1| amino acid transporter [Populus trichocarpa]... 68 9e-10 >ref|XP_003554948.1| PREDICTED: sodium-coupled neutral amino acid transporter 1-like [Glycine max] Length = 531 Score = 74.3 bits (181), Expect = 9e-12 Identities = 36/41 (87%), Positives = 40/41 (97%) Frame = -2 Query: 299 DRHNIATKSDKILSVFMIVLAVLSNSVAIYSDAYALIKKNE 177 DRHNI TK+DK+LSVFMIVLAVLSN+VAIYSDAYALIKKN+ Sbjct: 488 DRHNITTKADKVLSVFMIVLAVLSNAVAIYSDAYALIKKNK 528 >ref|XP_002534057.1| amino acid transporter, putative [Ricinus communis] gi|223525920|gb|EEF28328.1| amino acid transporter, putative [Ricinus communis] Length = 461 Score = 71.6 bits (174), Expect = 6e-11 Identities = 35/42 (83%), Positives = 38/42 (90%) Frame = -2 Query: 299 DRHNIATKSDKILSVFMIVLAVLSNSVAIYSDAYALIKKNEN 174 DRHNIATK DKILS+FMI LAV SN+VAIYSDAYALIKKN + Sbjct: 417 DRHNIATKKDKILSIFMISLAVFSNAVAIYSDAYALIKKNSS 458 >ref|XP_002329300.1| amino acid transporter [Populus trichocarpa] gi|222870754|gb|EEF07885.1| amino acid transporter [Populus trichocarpa] Length = 460 Score = 70.1 bits (170), Expect = 2e-10 Identities = 34/40 (85%), Positives = 37/40 (92%) Frame = -2 Query: 299 DRHNIATKSDKILSVFMIVLAVLSNSVAIYSDAYALIKKN 180 DRHNIATK DKIL +FMIVLAV SN+VAIYSDAYALIK+N Sbjct: 416 DRHNIATKRDKILCIFMIVLAVFSNAVAIYSDAYALIKRN 455 >ref|XP_003531894.1| PREDICTED: sodium-coupled neutral amino acid transporter 2-like [Glycine max] Length = 466 Score = 68.6 bits (166), Expect = 5e-10 Identities = 35/41 (85%), Positives = 38/41 (92%) Frame = -2 Query: 299 DRHNIATKSDKILSVFMIVLAVLSNSVAIYSDAYALIKKNE 177 DR+NIATKSDKILSV MIVLAV SN VAIYSDAYALIK+N+ Sbjct: 422 DRYNIATKSDKILSVIMIVLAVFSNVVAIYSDAYALIKQNK 462 >ref|XP_002331285.1| amino acid transporter [Populus trichocarpa] gi|222873710|gb|EEF10841.1| amino acid transporter [Populus trichocarpa] Length = 460 Score = 67.8 bits (164), Expect = 9e-10 Identities = 33/40 (82%), Positives = 35/40 (87%) Frame = -2 Query: 299 DRHNIATKSDKILSVFMIVLAVLSNSVAIYSDAYALIKKN 180 DRHNIA+K DKIL +FMI LAV SN VAIYSDAYALIKKN Sbjct: 416 DRHNIASKRDKILCIFMIALAVFSNGVAIYSDAYALIKKN 455