BLASTX nr result
ID: Glycyrrhiza24_contig00019101
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza24_contig00019101 (218 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003608458.1| hypothetical protein MTR_4g095320 [Medicago ... 68 9e-10 >ref|XP_003608458.1| hypothetical protein MTR_4g095320 [Medicago truncatula] gi|355509513|gb|AES90655.1| hypothetical protein MTR_4g095320 [Medicago truncatula] Length = 339 Score = 67.8 bits (164), Expect = 9e-10 Identities = 38/57 (66%), Positives = 42/57 (73%), Gaps = 4/57 (7%) Frame = +3 Query: 3 GLFSNNKEPQMCVADEVFFQGQILPLRLSFSSEAGLLSTTGLK----RSSDGGKQFN 161 GL S EP+MCVADEVFFQGQILP R SFSS+AGLL+TTG + D GKQFN Sbjct: 58 GLLST--EPKMCVADEVFFQGQILPSRASFSSQAGLLTTTGSQFQRDDDHDHGKQFN 112