BLASTX nr result
ID: Glycyrrhiza24_contig00019059
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza24_contig00019059 (287 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003540667.1| PREDICTED: pentatricopeptide repeat-containi... 63 3e-08 ref|XP_003539003.1| PREDICTED: pentatricopeptide repeat-containi... 60 1e-07 >ref|XP_003540667.1| PREDICTED: pentatricopeptide repeat-containing protein At5g50280, chloroplastic-like [Glycine max] Length = 711 Score = 62.8 bits (151), Expect = 3e-08 Identities = 28/36 (77%), Positives = 30/36 (83%) Frame = -2 Query: 145 HDPHDPIYKFFKTRTLVSSQSPGKEGKLSLLRNHRV 38 HDP DPIYKFFKTRT SSQ PGKEGKLSL +N R+ Sbjct: 92 HDPDDPIYKFFKTRTRFSSQDPGKEGKLSLQKNRRI 127 >ref|XP_003539003.1| PREDICTED: pentatricopeptide repeat-containing protein At5g50280, chloroplastic-like [Glycine max] Length = 703 Score = 60.5 bits (145), Expect = 1e-07 Identities = 27/36 (75%), Positives = 30/36 (83%) Frame = -2 Query: 145 HDPHDPIYKFFKTRTLVSSQSPGKEGKLSLLRNHRV 38 +DP DPIYKFFKTRT SSQ PGKEGKLSL +N R+ Sbjct: 84 YDPDDPIYKFFKTRTRFSSQDPGKEGKLSLQKNRRI 119