BLASTX nr result
ID: Glycyrrhiza24_contig00018779
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza24_contig00018779 (859 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003543484.1| PREDICTED: uncharacterized protein LOC100815... 58 2e-06 >ref|XP_003543484.1| PREDICTED: uncharacterized protein LOC100815974 [Glycine max] gi|255640885|gb|ACU20725.1| unknown [Glycine max] Length = 75 Score = 58.2 bits (139), Expect = 2e-06 Identities = 33/65 (50%), Positives = 41/65 (63%), Gaps = 2/65 (3%) Frame = +1 Query: 229 KEKAASFPPKRGKIKAHIFNSLVKIVTSTVSKAGK-FKXXXXXXXXXXXATSTPPPSD-Y 402 + K AS PPKRG+IKA IF SLV V ST+SK G+ + A+STPPPS Y Sbjct: 6 QRKKASLPPKRGQIKAQIFTSLVNSVASTISKTGESLRNVIGNGGGSGSASSTPPPSSGY 65 Query: 403 NSDAS 417 NS+A+ Sbjct: 66 NSEAN 70