BLASTX nr result
ID: Glycyrrhiza24_contig00018755
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza24_contig00018755 (240 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_200378.1| RNA recognition motif-containing protein [Arabi... 69 3e-10 ref|NP_001190548.1| RNA recognition motif-containing protein [Ar... 69 3e-10 ref|XP_002866107.1| hypothetical protein ARALYDRAFT_495654 [Arab... 68 9e-10 ref|XP_002522751.1| RNA-binding protein, putative [Ricinus commu... 67 1e-09 ref|XP_003532176.1| PREDICTED: uncharacterized protein LOC100813... 66 3e-09 >ref|NP_200378.1| RNA recognition motif-containing protein [Arabidopsis thaliana] gi|9758601|dbj|BAB09234.1| unnamed protein product [Arabidopsis thaliana] gi|332009282|gb|AED96665.1| RNA recognition motif-containing protein [Arabidopsis thaliana] Length = 710 Score = 69.3 bits (168), Expect = 3e-10 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +2 Query: 146 LFVGDLHWWTTDAELEAELCKYGQVKEVKFF 238 LFVGDLHWWTTDAELEAELCKYG VKEVKFF Sbjct: 236 LFVGDLHWWTTDAELEAELCKYGAVKEVKFF 266 >ref|NP_001190548.1| RNA recognition motif-containing protein [Arabidopsis thaliana] gi|332009283|gb|AED96666.1| RNA recognition motif-containing protein [Arabidopsis thaliana] Length = 585 Score = 69.3 bits (168), Expect = 3e-10 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +2 Query: 146 LFVGDLHWWTTDAELEAELCKYGQVKEVKFF 238 LFVGDLHWWTTDAELEAELCKYG VKEVKFF Sbjct: 236 LFVGDLHWWTTDAELEAELCKYGAVKEVKFF 266 >ref|XP_002866107.1| hypothetical protein ARALYDRAFT_495654 [Arabidopsis lyrata subsp. lyrata] gi|297311942|gb|EFH42366.1| hypothetical protein ARALYDRAFT_495654 [Arabidopsis lyrata subsp. lyrata] Length = 706 Score = 67.8 bits (164), Expect = 9e-10 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = +2 Query: 146 LFVGDLHWWTTDAELEAELCKYGQVKEVKFF 238 LFVG+LHWWTTDAELEAELCKYG VKEVKFF Sbjct: 233 LFVGELHWWTTDAELEAELCKYGAVKEVKFF 263 >ref|XP_002522751.1| RNA-binding protein, putative [Ricinus communis] gi|223537989|gb|EEF39602.1| RNA-binding protein, putative [Ricinus communis] Length = 702 Score = 67.4 bits (163), Expect = 1e-09 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = +2 Query: 146 LFVGDLHWWTTDAELEAELCKYGQVKEVKFF 238 LFVG+LHWWTTDAELEAELCKYG VKEVKFF Sbjct: 224 LFVGELHWWTTDAELEAELCKYGVVKEVKFF 254 >ref|XP_003532176.1| PREDICTED: uncharacterized protein LOC100813702 [Glycine max] Length = 693 Score = 65.9 bits (159), Expect = 3e-09 Identities = 29/31 (93%), Positives = 29/31 (93%) Frame = +2 Query: 146 LFVGDLHWWTTDAELEAELCKYGQVKEVKFF 238 LFVGDLHWWTTDAELEAEL KYG VKEVKFF Sbjct: 228 LFVGDLHWWTTDAELEAELSKYGSVKEVKFF 258