BLASTX nr result
ID: Glycyrrhiza24_contig00018169
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza24_contig00018169 (453 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003556961.1| PREDICTED: LOW QUALITY PROTEIN: AP2-like eth... 62 6e-08 ref|XP_003527742.1| PREDICTED: AP2-like ethylene-responsive tran... 61 8e-08 ref|XP_003523631.1| PREDICTED: AP2-like ethylene-responsive tran... 58 7e-07 >ref|XP_003556961.1| PREDICTED: LOW QUALITY PROTEIN: AP2-like ethylene-responsive transcription factor ANT-like [Glycine max] Length = 686 Score = 61.6 bits (148), Expect = 6e-08 Identities = 29/35 (82%), Positives = 31/35 (88%) Frame = +3 Query: 342 MKSMNDSNTDDDGNNHNWLLGFSLSPHMKMEVSSS 446 MKSMNDSNT DDGNNHN LGFSLSPHMKM+V +S Sbjct: 1 MKSMNDSNTVDDGNNHNNWLGFSLSPHMKMDVVTS 35 >ref|XP_003527742.1| PREDICTED: AP2-like ethylene-responsive transcription factor ANT-like [Glycine max] Length = 635 Score = 61.2 bits (147), Expect = 8e-08 Identities = 28/35 (80%), Positives = 31/35 (88%) Frame = +3 Query: 342 MKSMNDSNTDDDGNNHNWLLGFSLSPHMKMEVSSS 446 MK MN+SN DDGNNHNW LGFSLSPHMKMEV+S+ Sbjct: 1 MKRMNESNNTDDGNNHNW-LGFSLSPHMKMEVTSA 34 >ref|XP_003523631.1| PREDICTED: AP2-like ethylene-responsive transcription factor ANT-like [Glycine max] Length = 637 Score = 58.2 bits (139), Expect = 7e-07 Identities = 26/35 (74%), Positives = 30/35 (85%) Frame = +3 Query: 342 MKSMNDSNTDDDGNNHNWLLGFSLSPHMKMEVSSS 446 MK +N+SN DDGNNHNW LGFSLSPHMKME +S+ Sbjct: 1 MKRINESNNTDDGNNHNW-LGFSLSPHMKMEATSA 34