BLASTX nr result
ID: Glycyrrhiza24_contig00018084
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza24_contig00018084 (221 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003550576.1| PREDICTED: tRNA pseudouridine synthase A 1-l... 64 1e-08 ref|XP_003541334.1| PREDICTED: tRNA pseudouridine synthase A 1-l... 63 2e-08 ref|XP_003609879.1| tRNA pseudouridine synthase family protein [... 57 2e-06 ref|XP_003609878.1| tRNA pseudouridine synthase family protein [... 57 2e-06 >ref|XP_003550576.1| PREDICTED: tRNA pseudouridine synthase A 1-like [Glycine max] Length = 309 Score = 64.3 bits (155), Expect = 1e-08 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = +1 Query: 124 HGVKPIIQDGYKWRLVLAYDGTRYAGWQYQQS 219 HGVKPI QD YKWRLVLAYDGT+YAGWQYQQS Sbjct: 17 HGVKPI-QDWYKWRLVLAYDGTKYAGWQYQQS 47 >ref|XP_003541334.1| PREDICTED: tRNA pseudouridine synthase A 1-like [Glycine max] Length = 327 Score = 63.2 bits (152), Expect = 2e-08 Identities = 27/32 (84%), Positives = 31/32 (96%) Frame = +1 Query: 124 HGVKPIIQDGYKWRLVLAYDGTRYAGWQYQQS 219 HGVK +IQDGYKWR+VLAYDGT+YAGWQYQ+S Sbjct: 35 HGVK-LIQDGYKWRIVLAYDGTQYAGWQYQES 65 >ref|XP_003609879.1| tRNA pseudouridine synthase family protein [Medicago truncatula] gi|355510934|gb|AES92076.1| tRNA pseudouridine synthase family protein [Medicago truncatula] Length = 322 Score = 57.0 bits (136), Expect = 2e-06 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = +1 Query: 130 VKPIIQDGYKWRLVLAYDGTRYAGWQYQQS 219 VKP QDGYKWRL+L+YDGTRYAGWQYQ+S Sbjct: 35 VKPN-QDGYKWRLLLSYDGTRYAGWQYQES 63 >ref|XP_003609878.1| tRNA pseudouridine synthase family protein [Medicago truncatula] gi|355510933|gb|AES92075.1| tRNA pseudouridine synthase family protein [Medicago truncatula] Length = 350 Score = 57.0 bits (136), Expect = 2e-06 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = +1 Query: 130 VKPIIQDGYKWRLVLAYDGTRYAGWQYQQS 219 VKP QDGYKWRL+L+YDGTRYAGWQYQ+S Sbjct: 63 VKPN-QDGYKWRLLLSYDGTRYAGWQYQES 91