BLASTX nr result
ID: Glycyrrhiza24_contig00018024
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza24_contig00018024 (242 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003610363.1| Pentatricopeptide repeat-containing protein ... 84 9e-15 ref|XP_003541466.1| PREDICTED: pentatricopeptide repeat-containi... 76 3e-12 >ref|XP_003610363.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355511418|gb|AES92560.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 734 Score = 84.3 bits (207), Expect = 9e-15 Identities = 41/53 (77%), Positives = 44/53 (83%) Frame = +2 Query: 2 QIDEIRSELRLLTKLMKDEGYQPLSDSLPETIRDELTDQEGSHEIQLRVCGGL 160 Q+DEIR EL LLTKLM DEGYQPL D LPET+ D LTDQEGS EIQ+ VCGGL Sbjct: 682 QVDEIRLELELLTKLMIDEGYQPLLDRLPETVIDNLTDQEGSDEIQISVCGGL 734 >ref|XP_003541466.1| PREDICTED: pentatricopeptide repeat-containing protein At2g33680-like [Glycine max] Length = 775 Score = 75.9 bits (185), Expect = 3e-12 Identities = 41/53 (77%), Positives = 43/53 (81%), Gaps = 1/53 (1%) Frame = +2 Query: 2 QIDEIRSELRLLTKLMKDEGYQPLSDSL-PETIRDELTDQEGSHEIQLRVCGG 157 QIDEIR L+LLTKLMKDEGYQPL DSL PETI D+L DQE SHEIQLR G Sbjct: 682 QIDEIRLGLKLLTKLMKDEGYQPLLDSLPPETISDDLKDQEDSHEIQLRFIYG 734