BLASTX nr result
ID: Glycyrrhiza24_contig00017949
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza24_contig00017949 (225 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003542514.1| PREDICTED: E3 ubiquitin-protein ligase MGRN1... 133 1e-29 ref|XP_003537289.1| PREDICTED: E3 ubiquitin-protein ligase MGRN1... 129 2e-28 ref|XP_004137817.1| PREDICTED: probable E3 ubiquitin-protein lig... 122 2e-26 ref|XP_002519543.1| mahogunin, putative [Ricinus communis] gi|22... 122 2e-26 ref|XP_002326350.1| predicted protein [Populus trichocarpa] gi|2... 122 2e-26 >ref|XP_003542514.1| PREDICTED: E3 ubiquitin-protein ligase MGRN1-like [Glycine max] Length = 349 Score = 133 bits (335), Expect = 1e-29 Identities = 60/62 (96%), Positives = 60/62 (96%) Frame = +2 Query: 2 NDPGKECVICLSEPRDTTVLPCCHMCMCSGCAKVLWFQTNRCPICRQPVERLLEIKVGPE 181 NDPGKECVICLSEPRDTTVLPC HMCMCSGCAKVL FQTNRCPICRQPVERLLEIKVGPE Sbjct: 287 NDPGKECVICLSEPRDTTVLPCRHMCMCSGCAKVLRFQTNRCPICRQPVERLLEIKVGPE 346 Query: 182 PE 187 PE Sbjct: 347 PE 348 >ref|XP_003537289.1| PREDICTED: E3 ubiquitin-protein ligase MGRN1-like [Glycine max] Length = 349 Score = 129 bits (325), Expect = 2e-28 Identities = 59/62 (95%), Positives = 59/62 (95%) Frame = +2 Query: 2 NDPGKECVICLSEPRDTTVLPCCHMCMCSGCAKVLWFQTNRCPICRQPVERLLEIKVGPE 181 NDPGKECVICLSEPRDTTVLPC HMCMCSGCAKVL FQTNRCPICRQPVERLLEIKVGPE Sbjct: 287 NDPGKECVICLSEPRDTTVLPCRHMCMCSGCAKVLRFQTNRCPICRQPVERLLEIKVGPE 346 Query: 182 PE 187 E Sbjct: 347 LE 348 >ref|XP_004137817.1| PREDICTED: probable E3 ubiquitin-protein ligase LOG2-like [Cucumis sativus] gi|449513666|ref|XP_004164388.1| PREDICTED: probable E3 ubiquitin-protein ligase LOG2-like [Cucumis sativus] Length = 368 Score = 122 bits (307), Expect = 2e-26 Identities = 55/62 (88%), Positives = 57/62 (91%) Frame = +2 Query: 2 NDPGKECVICLSEPRDTTVLPCCHMCMCSGCAKVLWFQTNRCPICRQPVERLLEIKVGPE 181 NDPGKECVICLSEPRDTTVLPC HMCMCSGCAKVL FQTNRCPICRQPV+RLLEI+V Sbjct: 305 NDPGKECVICLSEPRDTTVLPCRHMCMCSGCAKVLRFQTNRCPICRQPVDRLLEIRVSNG 364 Query: 182 PE 187 PE Sbjct: 365 PE 366 >ref|XP_002519543.1| mahogunin, putative [Ricinus communis] gi|223541406|gb|EEF42957.1| mahogunin, putative [Ricinus communis] Length = 306 Score = 122 bits (307), Expect = 2e-26 Identities = 55/62 (88%), Positives = 57/62 (91%) Frame = +2 Query: 2 NDPGKECVICLSEPRDTTVLPCCHMCMCSGCAKVLWFQTNRCPICRQPVERLLEIKVGPE 181 NDPGKECVICLSEPRDTTVLPC HMCMCSGCAKVL +QTNRCPICRQPVERLLEIKV Sbjct: 244 NDPGKECVICLSEPRDTTVLPCRHMCMCSGCAKVLRYQTNRCPICRQPVERLLEIKVNNG 303 Query: 182 PE 187 P+ Sbjct: 304 PD 305 >ref|XP_002326350.1| predicted protein [Populus trichocarpa] gi|222833543|gb|EEE72020.1| predicted protein [Populus trichocarpa] Length = 284 Score = 122 bits (307), Expect = 2e-26 Identities = 55/62 (88%), Positives = 57/62 (91%) Frame = +2 Query: 2 NDPGKECVICLSEPRDTTVLPCCHMCMCSGCAKVLWFQTNRCPICRQPVERLLEIKVGPE 181 NDPGKECVICLSEPRDTTVLPC HMCMCSGCAKVL FQTNRCPICRQPV+RLLEIKV Sbjct: 222 NDPGKECVICLSEPRDTTVLPCRHMCMCSGCAKVLRFQTNRCPICRQPVDRLLEIKVNNG 281 Query: 182 PE 187 P+ Sbjct: 282 PD 283