BLASTX nr result
ID: Glycyrrhiza24_contig00017886
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza24_contig00017886 (243 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003526263.1| PREDICTED: uncharacterized protein LOC100797... 60 1e-07 ref|XP_003607514.1| hypothetical protein MTR_4g078860 [Medicago ... 56 3e-06 >ref|XP_003526263.1| PREDICTED: uncharacterized protein LOC100797480 [Glycine max] Length = 1768 Score = 60.5 bits (145), Expect = 1e-07 Identities = 32/47 (68%), Positives = 38/47 (80%) Frame = -1 Query: 141 IGKLLGWKGKPCGRGGHARGRRSTRSRQKPAAAKVDVIDDGERDTPR 1 +GKLL WKG+PC +GG+ARG RS RS QK + AKVDVI GERDTP+ Sbjct: 1585 MGKLLEWKGRPCRQGGNARGPRSIRSWQK-SEAKVDVI-TGERDTPK 1629 >ref|XP_003607514.1| hypothetical protein MTR_4g078860 [Medicago truncatula] gi|355508569|gb|AES89711.1| hypothetical protein MTR_4g078860 [Medicago truncatula] Length = 1573 Score = 55.8 bits (133), Expect = 3e-06 Identities = 31/46 (67%), Positives = 36/46 (78%) Frame = -1 Query: 138 GKLLGWKGKPCGRGGHARGRRSTRSRQKPAAAKVDVIDDGERDTPR 1 G+LLGWKG P G+G H RGRRS RSR+KP AAK+DVI ER TP+ Sbjct: 1396 GRLLGWKGTPNGQG-HTRGRRSIRSRKKP-AAKMDVI-TSERGTPK 1438