BLASTX nr result
ID: Glycyrrhiza24_contig00017867
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza24_contig00017867 (464 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003530549.1| PREDICTED: putative pentatricopeptide repeat... 108 3e-22 ref|XP_002519191.1| pentatricopeptide repeat-containing protein,... 100 2e-19 ref|XP_004162218.1| PREDICTED: putative pentatricopeptide repeat... 88 8e-16 ref|XP_004134500.1| PREDICTED: LOW QUALITY PROTEIN: putative pen... 88 8e-16 ref|XP_002885175.1| pentatricopeptide repeat-containing protein ... 84 9e-15 >ref|XP_003530549.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g16890, mitochondrial-like [Glycine max] Length = 678 Score = 108 bits (271), Expect = 3e-22 Identities = 59/114 (51%), Positives = 72/114 (63%) Frame = -2 Query: 352 LRPFSTSPQQPLXXXXXXXXXXXXXXXIDHSHISKLLSKTDSDWSLLLNHELHSKRLLLT 173 L P T P P IDH +IS+LLS+ D W++LLNH+L SK LLL Sbjct: 29 LNPLQTPPSSP------------SSPPIDHLYISQLLSRPD--WAVLLNHDLSSKTLLLN 74 Query: 172 PRSLASIFQNQQNPLHSIKFYTWVSTTNPSLSKHPSVQRVLLNTLYRKGPVLLS 11 P SIFQNQQNP H+IKF++W+S NP+L+ H SV R L NTL+RKGP LLS Sbjct: 75 PSYAVSIFQNQQNPSHAIKFHSWLSHVNPTLAAHNSVHRALRNTLHRKGPALLS 128 >ref|XP_002519191.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223541506|gb|EEF43055.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 719 Score = 99.8 bits (247), Expect = 2e-19 Identities = 48/88 (54%), Positives = 63/88 (71%) Frame = -2 Query: 268 DHSHISKLLSKTDSDWSLLLNHELHSKRLLLTPRSLASIFQNQQNPLHSIKFYTWVSTTN 89 DH + S++LS+ DW LLLNHE +KR+ L S+AS+ QNQ+NPL+ +KFY WVS + Sbjct: 83 DHHYFSRILSR--HDWFLLLNHEFKAKRITLNSHSVASVLQNQENPLYPLKFYIWVSNMD 140 Query: 88 PSLSKHPSVQRVLLNTLYRKGPVLLSSE 5 P +K SV+ VL N LYRKGPV+LS E Sbjct: 141 PLFAKDQSVKGVLANCLYRKGPVVLSVE 168 >ref|XP_004162218.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g16890, mitochondrial-like [Cucumis sativus] Length = 697 Score = 87.8 bits (216), Expect = 8e-16 Identities = 46/89 (51%), Positives = 61/89 (68%), Gaps = 3/89 (3%) Frame = -2 Query: 268 DHSHISKLLSKTDSDWSLLLNHELHSKRLLLTPRSLASIFQNQQNPLHSIKFYTWVSTTN 89 D S+ISK+L DW LLLNHE +KR++L+P+ + SI QNQ NPL +I+FY WVS + Sbjct: 92 DRSYISKIL--LSKDWFLLLNHEFKAKRVVLSPQFVVSILQNQDNPLSAIRFYIWVSNVD 149 Query: 88 PSLSKHPSVQRVLLNTLYRKG---PVLLS 11 P L K +Q VL+ L+R+G PVLLS Sbjct: 150 PLLVKKQLIQGVLVRNLHREGPDRPVLLS 178 >ref|XP_004134500.1| PREDICTED: LOW QUALITY PROTEIN: putative pentatricopeptide repeat-containing protein At3g16890, mitochondrial-like [Cucumis sativus] Length = 688 Score = 87.8 bits (216), Expect = 8e-16 Identities = 46/89 (51%), Positives = 61/89 (68%), Gaps = 3/89 (3%) Frame = -2 Query: 268 DHSHISKLLSKTDSDWSLLLNHELHSKRLLLTPRSLASIFQNQQNPLHSIKFYTWVSTTN 89 D S+ISK+L DW LLLNHE +KR++L+P+ + SI QNQ NPL +I+FY WVS + Sbjct: 92 DRSYISKIL--LSKDWFLLLNHEFKAKRVVLSPQFVVSILQNQDNPLSAIRFYIWVSNVD 149 Query: 88 PSLSKHPSVQRVLLNTLYRKG---PVLLS 11 P L K +Q VL+ L+R+G PVLLS Sbjct: 150 PLLVKKQLIQGVLVRNLHREGPDRPVLLS 178 >ref|XP_002885175.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297331015|gb|EFH61434.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 653 Score = 84.3 bits (207), Expect = 9e-15 Identities = 41/85 (48%), Positives = 59/85 (69%) Frame = -2 Query: 259 HISKLLSKTDSDWSLLLNHELHSKRLLLTPRSLASIFQNQQNPLHSIKFYTWVSTTNPSL 80 +IS+++ + DW L+LN E + R+ L R + S+ QNQ NPLHS++FY WVS T+P Sbjct: 43 YISQVIER--KDWFLILNQEFTTHRIGLNIRFVISVLQNQDNPLHSLRFYLWVSNTDPVY 100 Query: 79 SKHPSVQRVLLNTLYRKGPVLLSSE 5 +K S++ VL N L+RKGP+LLS E Sbjct: 101 AKDQSLKSVLGNALFRKGPLLLSME 125