BLASTX nr result
ID: Glycyrrhiza24_contig00017811
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza24_contig00017811 (264 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003544143.1| PREDICTED: uncharacterized protein LOC100820... 104 9e-21 ref|NP_001241633.1| uncharacterized protein LOC100815870 [Glycin... 104 9e-21 ref|XP_003552597.1| PREDICTED: uncharacterized protein LOC100782... 95 5e-18 ref|XP_003538438.1| PREDICTED: uncharacterized protein LOC100783... 95 5e-18 ref|XP_003600816.1| hypothetical protein MTR_3g069720 [Medicago ... 90 2e-16 >ref|XP_003544143.1| PREDICTED: uncharacterized protein LOC100820581 [Glycine max] Length = 427 Score = 104 bits (259), Expect = 9e-21 Identities = 49/55 (89%), Positives = 51/55 (92%) Frame = +2 Query: 95 MKKLCPNLDREDGLETVLEVPIPDEIFTIKSGTTRAWQNMKSWMKPNVVESRSSS 259 MKKLCPNL REDGLETVLEVPIP+EIFTIKSGT+RAW NMKSWMKPNV SRSSS Sbjct: 1 MKKLCPNLTREDGLETVLEVPIPEEIFTIKSGTSRAWHNMKSWMKPNVESSRSSS 55 >ref|NP_001241633.1| uncharacterized protein LOC100815870 [Glycine max] gi|255644858|gb|ACU22929.1| unknown [Glycine max] Length = 423 Score = 104 bits (259), Expect = 9e-21 Identities = 49/55 (89%), Positives = 51/55 (92%) Frame = +2 Query: 95 MKKLCPNLDREDGLETVLEVPIPDEIFTIKSGTTRAWQNMKSWMKPNVVESRSSS 259 MKKLCPNL REDGLETVLEVPIP+EIFTIKSGT+RAW NMKSWMKPNV SRSSS Sbjct: 1 MKKLCPNLTREDGLETVLEVPIPEEIFTIKSGTSRAWHNMKSWMKPNVESSRSSS 55 >ref|XP_003552597.1| PREDICTED: uncharacterized protein LOC100782214 [Glycine max] Length = 439 Score = 95.1 bits (235), Expect = 5e-18 Identities = 45/56 (80%), Positives = 51/56 (91%) Frame = +2 Query: 95 MKKLCPNLDREDGLETVLEVPIPDEIFTIKSGTTRAWQNMKSWMKPNVVESRSSSS 262 MKKLCPNLDREDGLETVLEVPIP+EI T KSGTT+AW NMK+WMKP+ ESRS+S+ Sbjct: 1 MKKLCPNLDREDGLETVLEVPIPEEILTHKSGTTKAWHNMKNWMKPH-AESRSNSA 55 >ref|XP_003538438.1| PREDICTED: uncharacterized protein LOC100783667 [Glycine max] Length = 436 Score = 95.1 bits (235), Expect = 5e-18 Identities = 45/56 (80%), Positives = 51/56 (91%) Frame = +2 Query: 95 MKKLCPNLDREDGLETVLEVPIPDEIFTIKSGTTRAWQNMKSWMKPNVVESRSSSS 262 MKKLCPNLDREDGLETVLEVPIP+EI T KSGTT+AW NMK+WMKP+ ESRS+S+ Sbjct: 1 MKKLCPNLDREDGLETVLEVPIPEEILTHKSGTTKAWHNMKNWMKPH-AESRSNSA 55 >ref|XP_003600816.1| hypothetical protein MTR_3g069720 [Medicago truncatula] gi|355489864|gb|AES71067.1| hypothetical protein MTR_3g069720 [Medicago truncatula] Length = 489 Score = 89.7 bits (221), Expect = 2e-16 Identities = 40/55 (72%), Positives = 48/55 (87%) Frame = +2 Query: 95 MKKLCPNLDREDGLETVLEVPIPDEIFTIKSGTTRAWQNMKSWMKPNVVESRSSS 259 + KL PNLDREDGLETVLEVPIP+EIFT KSGT +AWQN+K WMKPN E++++S Sbjct: 49 LDKLSPNLDREDGLETVLEVPIPEEIFTHKSGTMKAWQNVKFWMKPNAAEAKAAS 103