BLASTX nr result
ID: Glycyrrhiza24_contig00017416
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza24_contig00017416 (381 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003607458.1| Callose synthase [Medicago truncatula] gi|35... 130 9e-29 ref|XP_004154600.1| PREDICTED: LOW QUALITY PROTEIN: callose synt... 124 1e-26 ref|XP_004140034.1| PREDICTED: callose synthase 12-like [Cucumis... 124 1e-26 ref|NP_192264.1| callose synthase 12 [Arabidopsis thaliana] gi|7... 111 5e-23 ref|XP_002517915.1| transferase, transferring glycosyl groups, p... 110 1e-22 >ref|XP_003607458.1| Callose synthase [Medicago truncatula] gi|355508513|gb|AES89655.1| Callose synthase [Medicago truncatula] Length = 1815 Score = 130 bits (328), Expect = 9e-29 Identities = 61/72 (84%), Positives = 65/72 (90%) Frame = -2 Query: 218 MSLRHRHPPPGSATPPREDEPYNIIPVHNLLADHPSLRFPEVRAAAAALRSVGDLRPPPF 39 MSLRHR P S+TPP E+EPYNIIP+HNLLADHPSLRFPEVRAAAAALRSVG+LR PPF Sbjct: 1 MSLRHRQP---SSTPPHEEEPYNIIPIHNLLADHPSLRFPEVRAAAAALRSVGNLRRPPF 57 Query: 38 GQWRPHMDLLDW 3 GQWRPH DLLDW Sbjct: 58 GQWRPHYDLLDW 69 >ref|XP_004154600.1| PREDICTED: LOW QUALITY PROTEIN: callose synthase 12-like [Cucumis sativus] Length = 1767 Score = 124 bits (310), Expect = 1e-26 Identities = 55/72 (76%), Positives = 61/72 (84%) Frame = -2 Query: 218 MSLRHRHPPPGSATPPREDEPYNIIPVHNLLADHPSLRFPEVRAAAAALRSVGDLRPPPF 39 MS RHR PPP PP E+EPYNIIP+HNLLADHPSLRFPEVRAA AALR+VGDLR PP+ Sbjct: 1 MSSRHRPPPPPRPGPPDENEPYNIIPIHNLLADHPSLRFPEVRAATAALRAVGDLRKPPY 60 Query: 38 GQWRPHMDLLDW 3 QW PH+D+LDW Sbjct: 61 VQWLPHLDILDW 72 >ref|XP_004140034.1| PREDICTED: callose synthase 12-like [Cucumis sativus] Length = 1767 Score = 124 bits (310), Expect = 1e-26 Identities = 55/72 (76%), Positives = 61/72 (84%) Frame = -2 Query: 218 MSLRHRHPPPGSATPPREDEPYNIIPVHNLLADHPSLRFPEVRAAAAALRSVGDLRPPPF 39 MS RHR PPP PP E+EPYNIIP+HNLLADHPSLRFPEVRAA AALR+VGDLR PP+ Sbjct: 1 MSSRHRPPPPPRPGPPDENEPYNIIPIHNLLADHPSLRFPEVRAATAALRAVGDLRKPPY 60 Query: 38 GQWRPHMDLLDW 3 QW PH+D+LDW Sbjct: 61 VQWLPHLDILDW 72 >ref|NP_192264.1| callose synthase 12 [Arabidopsis thaliana] gi|75216593|sp|Q9ZT82.1|CALSC_ARATH RecName: Full=Callose synthase 12; AltName: Full=1,3-beta-glucan synthase; AltName: Full=Protein GLUCAN SYNTHASE-LIKE 5; AltName: Full=Protein POWDERY MILDEW RESISTANT 4 gi|4206209|gb|AAD11597.1| putative glucan synthase component [Arabidopsis thaliana] gi|4263042|gb|AAD15311.1| putative glucan synthase component [Arabidopsis thaliana] gi|7270678|emb|CAB77840.1| putative glucan synthase component [Arabidopsis thaliana] gi|332656936|gb|AEE82336.1| callose synthase 12 [Arabidopsis thaliana] Length = 1780 Score = 111 bits (278), Expect = 5e-23 Identities = 55/78 (70%), Positives = 61/78 (78%), Gaps = 6/78 (7%) Frame = -2 Query: 218 MSLRHRHPPPGSATPPR------EDEPYNIIPVHNLLADHPSLRFPEVRAAAAALRSVGD 57 MSLRHR PP + P E+EPYNIIPV+NLLADHPSLRFPEVRAAAAAL++VGD Sbjct: 1 MSLRHRTVPPQTGRPLAAEAVGIEEEPYNIIPVNNLLADHPSLRFPEVRAAAAALKTVGD 60 Query: 56 LRPPPFGQWRPHMDLLDW 3 LR PP+ QWR H DLLDW Sbjct: 61 LRRPPYVQWRSHYDLLDW 78 >ref|XP_002517915.1| transferase, transferring glycosyl groups, putative [Ricinus communis] gi|223542897|gb|EEF44433.1| transferase, transferring glycosyl groups, putative [Ricinus communis] Length = 1767 Score = 110 bits (275), Expect = 1e-22 Identities = 52/72 (72%), Positives = 58/72 (80%), Gaps = 1/72 (1%) Frame = -2 Query: 215 SLRHR-HPPPGSATPPREDEPYNIIPVHNLLADHPSLRFPEVRAAAAALRSVGDLRPPPF 39 +LRHR P P P E+E YNIIPVHNLLADHPSLR+PEVRAAAAALR+VG+LR PP+ Sbjct: 3 TLRHRTRPGPNRPEQPPEEEAYNIIPVHNLLADHPSLRYPEVRAAAAALRTVGNLRKPPY 62 Query: 38 GQWRPHMDLLDW 3 QW P MDLLDW Sbjct: 63 AQWHPSMDLLDW 74