BLASTX nr result
ID: Glycyrrhiza24_contig00017277
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza24_contig00017277 (583 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003623623.1| Pentatricopeptide repeat-containing protein ... 74 2e-11 >ref|XP_003623623.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355498638|gb|AES79841.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 583 Score = 73.9 bits (180), Expect = 2e-11 Identities = 36/51 (70%), Positives = 42/51 (82%) Frame = +2 Query: 2 EEAVSALLLLHANRGIANRISYRVLIRELNAQGRVFCASFLFGLALKQGVV 154 +EAVS LLLL AN G +R+S+ VL+ ELNA GRVFCASFLFG+ALK GVV Sbjct: 448 DEAVSTLLLLQANGGFLDRVSFGVLVNELNAHGRVFCASFLFGVALKHGVV 498