BLASTX nr result
ID: Glycyrrhiza24_contig00016882
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza24_contig00016882 (683 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003528713.1| PREDICTED: C2 and GRAM domain-containing pro... 90 4e-16 ref|XP_003637602.1| Protein kinase C beta type [Medicago truncat... 87 4e-15 ref|XP_003594332.1| Synaptotagmin-1 [Medicago truncatula] gi|355... 80 4e-13 ref|XP_003534985.1| PREDICTED: C2 and GRAM domain-containing pro... 75 9e-12 ref|XP_003546208.1| PREDICTED: C2 and GRAM domain-containing pro... 74 3e-11 >ref|XP_003528713.1| PREDICTED: C2 and GRAM domain-containing protein At1g03370-like [Glycine max] Length = 1027 Score = 90.1 bits (222), Expect = 4e-16 Identities = 43/47 (91%), Positives = 45/47 (95%) Frame = -2 Query: 679 CKVQVLFGIEWLKSTKHHKRITKNILKNLQERLKLTFSIVEKEFLAK 539 CKVQVLFG EWLKSTKH KRITKNILKNLQERLKLTFS+VEKEFL+K Sbjct: 981 CKVQVLFGTEWLKSTKHQKRITKNILKNLQERLKLTFSLVEKEFLSK 1027 >ref|XP_003637602.1| Protein kinase C beta type [Medicago truncatula] gi|355503537|gb|AES84740.1| Protein kinase C beta type [Medicago truncatula] Length = 1038 Score = 86.7 bits (213), Expect = 4e-15 Identities = 41/48 (85%), Positives = 44/48 (91%) Frame = -2 Query: 682 GCKVQVLFGIEWLKSTKHHKRITKNILKNLQERLKLTFSIVEKEFLAK 539 GCKVQVLFGIEWLK+TKH KRITKNILKNLQER+KL S+VEKEFL K Sbjct: 991 GCKVQVLFGIEWLKNTKHQKRITKNILKNLQERIKLIVSLVEKEFLEK 1038 >ref|XP_003594332.1| Synaptotagmin-1 [Medicago truncatula] gi|355483380|gb|AES64583.1| Synaptotagmin-1 [Medicago truncatula] Length = 1042 Score = 80.1 bits (196), Expect = 4e-13 Identities = 36/48 (75%), Positives = 43/48 (89%) Frame = -2 Query: 682 GCKVQVLFGIEWLKSTKHHKRITKNILKNLQERLKLTFSIVEKEFLAK 539 GC+VQV FG+EWLKSTK+ KRITKNIL+NLQERLK+TFS+ EKE L + Sbjct: 995 GCRVQVFFGVEWLKSTKNQKRITKNILQNLQERLKVTFSLAEKELLPR 1042 >ref|XP_003534985.1| PREDICTED: C2 and GRAM domain-containing protein At1g03370-like [Glycine max] Length = 1018 Score = 75.5 bits (184), Expect = 9e-12 Identities = 34/48 (70%), Positives = 42/48 (87%) Frame = -2 Query: 682 GCKVQVLFGIEWLKSTKHHKRITKNILKNLQERLKLTFSIVEKEFLAK 539 GC+VQVLFG+EWLKS+K+ KR+TKNIL+NL ER K+TFS+ EKE L K Sbjct: 971 GCRVQVLFGMEWLKSSKNQKRLTKNILENLLERFKVTFSLAEKELLPK 1018 >ref|XP_003546208.1| PREDICTED: C2 and GRAM domain-containing protein At1g03370-like [Glycine max] Length = 1018 Score = 73.9 bits (180), Expect = 3e-11 Identities = 33/46 (71%), Positives = 41/46 (89%) Frame = -2 Query: 682 GCKVQVLFGIEWLKSTKHHKRITKNILKNLQERLKLTFSIVEKEFL 545 GC+VQVLFG+EWLKS+K+ KR+TKNIL+NL ER K+TFS+ EKE L Sbjct: 971 GCRVQVLFGMEWLKSSKNQKRLTKNILENLLERFKVTFSLAEKELL 1016