BLASTX nr result
ID: Glycyrrhiza24_contig00016837
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza24_contig00016837 (229 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFK34885.1| unknown [Medicago truncatula] 78 9e-13 ref|XP_003527101.1| PREDICTED: LRR repeats and ubiquitin-like do... 77 1e-12 ref|XP_003527102.1| PREDICTED: LRR repeats and ubiquitin-like do... 75 4e-12 ref|XP_002321465.1| predicted protein [Populus trichocarpa] gi|2... 75 6e-12 ref|XP_003522997.1| PREDICTED: LRR repeats and ubiquitin-like do... 75 7e-12 >gb|AFK34885.1| unknown [Medicago truncatula] Length = 261 Score = 77.8 bits (190), Expect = 9e-13 Identities = 36/41 (87%), Positives = 41/41 (100%) Frame = -2 Query: 123 IRSFPDEVLDLDRSVRTLDLTHNRIVDIPVEISKLINVQRL 1 +++FPDE++DLDRSVRTLDLTHNRIVDIPVEISKLINVQRL Sbjct: 32 LKTFPDEIIDLDRSVRTLDLTHNRIVDIPVEISKLINVQRL 72 >ref|XP_003527101.1| PREDICTED: LRR repeats and ubiquitin-like domain-containing protein At2g30105-like isoform 1 [Glycine max] Length = 261 Score = 77.0 bits (188), Expect = 1e-12 Identities = 36/41 (87%), Positives = 41/41 (100%) Frame = -2 Query: 123 IRSFPDEVLDLDRSVRTLDLTHNRIVDIPVEISKLINVQRL 1 +++FPDE+L+LDRSVRTLDLTHNRIVDIPVEISKLINVQRL Sbjct: 32 LKTFPDEILELDRSVRTLDLTHNRIVDIPVEISKLINVQRL 72 >ref|XP_003527102.1| PREDICTED: LRR repeats and ubiquitin-like domain-containing protein At2g30105-like isoform 2 [Glycine max] Length = 263 Score = 75.5 bits (184), Expect = 4e-12 Identities = 36/39 (92%), Positives = 39/39 (100%) Frame = -2 Query: 117 SFPDEVLDLDRSVRTLDLTHNRIVDIPVEISKLINVQRL 1 +FPDE+L+LDRSVRTLDLTHNRIVDIPVEISKLINVQRL Sbjct: 36 TFPDEILELDRSVRTLDLTHNRIVDIPVEISKLINVQRL 74 >ref|XP_002321465.1| predicted protein [Populus trichocarpa] gi|222868461|gb|EEF05592.1| predicted protein [Populus trichocarpa] Length = 279 Score = 75.1 bits (183), Expect = 6e-12 Identities = 42/72 (58%), Positives = 52/72 (72%) Frame = -2 Query: 216 KSTGFVLIYDFVENAKKHEPFVRITLLYYRLIRSFPDEVLDLDRSVRTLDLTHNRIVDIP 37 +STG V D A IT +Y+ I +FPDEVLDLD++VRTLDLTHN++VDIP Sbjct: 20 RSTGIVAFRDAKLKA--------ITYIYFIFI-AFPDEVLDLDKAVRTLDLTHNKLVDIP 70 Query: 36 VEISKLINVQRL 1 +EISKLIN+QRL Sbjct: 71 MEISKLINLQRL 82 >ref|XP_003522997.1| PREDICTED: LRR repeats and ubiquitin-like domain-containing protein At2g30105-like [Glycine max] Length = 261 Score = 74.7 bits (182), Expect = 7e-12 Identities = 35/41 (85%), Positives = 40/41 (97%) Frame = -2 Query: 123 IRSFPDEVLDLDRSVRTLDLTHNRIVDIPVEISKLINVQRL 1 +++FPDE+L+LD SVRTLDLTHNRIVDIPVEISKLINVQRL Sbjct: 32 LKTFPDEILELDTSVRTLDLTHNRIVDIPVEISKLINVQRL 72