BLASTX nr result
ID: Glycyrrhiza24_contig00016703
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza24_contig00016703 (210 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003624376.1| hypothetical protein MTR_7g082540 [Medicago ... 61 8e-08 ref|XP_003624360.1| hypothetical protein MTR_7g082390 [Medicago ... 61 8e-08 ref|XP_003551840.1| PREDICTED: probable receptor-like protein ki... 60 2e-07 ref|XP_002332860.1| predicted protein [Populus trichocarpa] gi|2... 57 2e-06 ref|XP_002516765.1| wall-associated kinase, putative [Ricinus co... 55 8e-06 >ref|XP_003624376.1| hypothetical protein MTR_7g082540 [Medicago truncatula] gi|355499391|gb|AES80594.1| hypothetical protein MTR_7g082540 [Medicago truncatula] Length = 260 Score = 61.2 bits (147), Expect = 8e-08 Identities = 23/34 (67%), Positives = 29/34 (85%) Frame = +2 Query: 107 GCDIMFSCGDIKNIGFPFWGENRPNGCGHPQLHL 208 GC+ +F+CG+IK IGFPFWGE+RP CGHP L+L Sbjct: 31 GCENLFNCGNIKQIGFPFWGEDRPKECGHPLLNL 64 >ref|XP_003624360.1| hypothetical protein MTR_7g082390 [Medicago truncatula] gi|355499375|gb|AES80578.1| hypothetical protein MTR_7g082390 [Medicago truncatula] Length = 256 Score = 61.2 bits (147), Expect = 8e-08 Identities = 23/34 (67%), Positives = 29/34 (85%) Frame = +2 Query: 107 GCDIMFSCGDIKNIGFPFWGENRPNGCGHPQLHL 208 GC+ +F+CG+IK IGFPFWGE+RP CGHP L+L Sbjct: 34 GCENLFNCGNIKQIGFPFWGEDRPKECGHPLLNL 67 >ref|XP_003551840.1| PREDICTED: probable receptor-like protein kinase At1g67000-like [Glycine max] Length = 1476 Score = 60.1 bits (144), Expect = 2e-07 Identities = 27/44 (61%), Positives = 32/44 (72%), Gaps = 1/44 (2%) Frame = +2 Query: 80 YWSSNVYYRGC-DIMFSCGDIKNIGFPFWGENRPNGCGHPQLHL 208 Y SS RGC + + SCG+IKNIGFPFWGE RP CGHP++ L Sbjct: 29 YLSSYNDDRGCTNQLISCGNIKNIGFPFWGEKRPRDCGHPRMQL 72 >ref|XP_002332860.1| predicted protein [Populus trichocarpa] gi|222833662|gb|EEE72139.1| predicted protein [Populus trichocarpa] Length = 413 Score = 56.6 bits (135), Expect = 2e-06 Identities = 20/36 (55%), Positives = 26/36 (72%) Frame = +2 Query: 101 YRGCDIMFSCGDIKNIGFPFWGENRPNGCGHPQLHL 208 Y C F CGD+K +G+PFWG NRP+ CG+P+L L Sbjct: 243 YVNCSNSFDCGDVKGVGYPFWGSNRPDYCGYPELKL 278 >ref|XP_002516765.1| wall-associated kinase, putative [Ricinus communis] gi|223544138|gb|EEF45663.1| wall-associated kinase, putative [Ricinus communis] Length = 685 Score = 54.7 bits (130), Expect = 8e-06 Identities = 20/36 (55%), Positives = 24/36 (66%) Frame = +2 Query: 101 YRGCDIMFSCGDIKNIGFPFWGENRPNGCGHPQLHL 208 Y C F CG+I +IG+PFWG NRP CGHP+ L Sbjct: 36 YLNCSQKFECGNITDIGYPFWGSNRPQYCGHPEFEL 71