BLASTX nr result
ID: Glycyrrhiza24_contig00016602
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza24_contig00016602 (400 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003554042.1| PREDICTED: meiotically up-regulated gene 71 ... 60 2e-07 ref|XP_003626157.1| ATP-binding domain-containing protein [Medic... 57 2e-06 >ref|XP_003554042.1| PREDICTED: meiotically up-regulated gene 71 protein-like [Glycine max] Length = 747 Score = 60.1 bits (144), Expect = 2e-07 Identities = 28/31 (90%), Positives = 31/31 (100%) Frame = -2 Query: 399 PIFNIVPVIGAGRSASSMDDVVTCELLARKS 307 PIFNIVPVIG+GRSASSMDDVVTCEL+A+KS Sbjct: 717 PIFNIVPVIGSGRSASSMDDVVTCELMAQKS 747 >ref|XP_003626157.1| ATP-binding domain-containing protein [Medicago truncatula] gi|355501172|gb|AES82375.1| ATP-binding domain-containing protein [Medicago truncatula] Length = 863 Score = 57.0 bits (136), Expect = 2e-06 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = -2 Query: 399 PIFNIVPVIGAGRSASSMDDVVTCELLARK 310 PIFNIVPV GAGRSASS+DDVVTCELLA+K Sbjct: 833 PIFNIVPVTGAGRSASSIDDVVTCELLAQK 862