BLASTX nr result
ID: Glycyrrhiza24_contig00016536
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza24_contig00016536 (596 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003541868.1| PREDICTED: uncharacterized protein LOC100779... 59 5e-07 >ref|XP_003541868.1| PREDICTED: uncharacterized protein LOC100779759 [Glycine max] Length = 109 Score = 59.3 bits (142), Expect = 5e-07 Identities = 31/58 (53%), Positives = 36/58 (62%), Gaps = 6/58 (10%) Frame = -3 Query: 372 SCFGSSPDPTN---PPFPLPSRTFRREMRHWRPTLRSISEDT---HTDRTAMVASGGG 217 SCFG + DPT P P PS+T RR HWRP L SISEDT H +RTA ++G G Sbjct: 6 SCFGGAGDPTGSTKPLVPPPSQTLRRNKSHWRPALGSISEDTAPPHRERTAAASAGDG 63