BLASTX nr result
ID: Glycyrrhiza24_contig00016464
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza24_contig00016464 (295 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ADI18733.1| hypothetical protein [uncultured Rhizobiales bact... 115 4e-24 ref|ZP_05822976.1| cell wall-associated hydrolase [Brucella abor... 89 5e-16 ref|ZP_12939398.1| hypothetical protein HMPREF9956_2590 [Staphyl... 87 1e-15 ref|ZP_06283573.1| conserved domain protein [Staphylococcus epid... 87 1e-15 ref|ZP_06284621.1| conserved domain protein [Staphylococcus epid... 87 1e-15 >gb|ADI18733.1| hypothetical protein [uncultured Rhizobiales bacterium HF4000_32B18] Length = 125 Score = 115 bits (288), Expect = 4e-24 Identities = 56/75 (74%), Positives = 60/75 (80%) Frame = +2 Query: 20 APRTISTGKLHALLHFHIRPINVVVFHGSQGIPCFEVGFPLRCFQRLSRPYIAILHCRWR 199 A R IST KLH LL FHI PINVVV++GSQG F+VGFPLRCFQRLSRPY+A L C WR Sbjct: 51 ANRAISTRKLHTLLRFHIVPINVVVYNGSQGRTRFQVGFPLRCFQRLSRPYVATLQCGWR 110 Query: 200 DNSSTRGTFTPVLSY 244 N STRGT TPVLSY Sbjct: 111 HNRSTRGTSTPVLSY 125 >ref|ZP_05822976.1| cell wall-associated hydrolase [Brucella abortus NCTC 8038] gi|260565853|ref|ZP_05836335.1| cell wall-associated hydrolase [Brucella melitensis bv. 1 str. 16M] gi|261219758|ref|ZP_05934039.1| cell wall-associated hydrolase [Brucella ceti M13/05/1] gi|261313976|ref|ZP_05953173.1| cell wall-associated hydrolase [Brucella pinnipedialis M163/99/10] gi|261316146|ref|ZP_05955343.1| cell wall-associated hydrolase [Brucella pinnipedialis B2/94] gi|261322647|ref|ZP_05961844.1| cell wall-associated hydrolase [Brucella ceti M644/93/1] gi|265984660|ref|ZP_06097395.1| cell wall-associated hydrolase [Brucella sp. 83/13] gi|265996870|ref|ZP_06109427.1| cell wall-associated hydrolase [Brucella ceti M490/95/1] gi|260095405|gb|EEW79284.1| cell wall-associated hydrolase [Brucella abortus NCTC 8038] gi|260151029|gb|EEW86125.1| cell wall-associated hydrolase [Brucella melitensis bv. 1 str. 16M] gi|260924847|gb|EEX91415.1| cell wall-associated hydrolase [Brucella ceti M13/05/1] gi|261295337|gb|EEX98833.1| cell wall-associated hydrolase [Brucella ceti M644/93/1] gi|261295369|gb|EEX98865.1| cell wall-associated hydrolase [Brucella pinnipedialis B2/94] gi|261303002|gb|EEY06499.1| cell wall-associated hydrolase [Brucella pinnipedialis M163/99/10] gi|262551237|gb|EEZ07328.1| cell wall-associated hydrolase [Brucella ceti M490/95/1] gi|264663252|gb|EEZ33513.1| cell wall-associated hydrolase [Brucella sp. 83/13] Length = 152 Score = 88.6 bits (218), Expect = 5e-16 Identities = 41/50 (82%), Positives = 46/50 (92%) Frame = +1 Query: 145 MLSAVIPSVHSYPALPLARQQLHQRYVHPGPLVLGANPLNIPTPTADRDR 294 M SAVIPSV+SYPA+ LA QQ+HQRYVHPGPLVLG +P+NIPTPTADRDR Sbjct: 1 MPSAVIPSVYSYPAMRLAPQQVHQRYVHPGPLVLGTDPVNIPTPTADRDR 50 >ref|ZP_12939398.1| hypothetical protein HMPREF9956_2590 [Staphylococcus epidermidis 14.1.R1.SE] gi|365232177|gb|EHM73188.1| hypothetical protein HMPREF9956_2590 [Staphylococcus epidermidis 14.1.R1.SE] Length = 105 Score = 87.0 bits (214), Expect = 1e-15 Identities = 39/50 (78%), Positives = 43/50 (86%) Frame = +1 Query: 145 MLSAVIPSVHSYPALPLARQQLHQRYVHPGPLVLGANPLNIPTPTADRDR 294 MLSA+IPS+HSYPA+PLARQ +HQRYVHPGPLVL PL PTPT DRDR Sbjct: 1 MLSALIPSIHSYPAMPLARQLVHQRYVHPGPLVLRTAPLKFPTPTTDRDR 50 >ref|ZP_06283573.1| conserved domain protein [Staphylococcus epidermidis SK135] gi|281296523|gb|EFA89036.1| conserved domain protein [Staphylococcus epidermidis SK135] Length = 54 Score = 87.0 bits (214), Expect = 1e-15 Identities = 39/50 (78%), Positives = 43/50 (86%) Frame = +1 Query: 145 MLSAVIPSVHSYPALPLARQQLHQRYVHPGPLVLGANPLNIPTPTADRDR 294 MLSA+IPS+HSYPA+PLARQ +HQRYVHPGPLVL PL PTPT DRDR Sbjct: 1 MLSALIPSIHSYPAMPLARQLVHQRYVHPGPLVLRTAPLKFPTPTTDRDR 50 >ref|ZP_06284621.1| conserved domain protein [Staphylococcus epidermidis SK135] gi|281294779|gb|EFA87306.1| conserved domain protein [Staphylococcus epidermidis SK135] Length = 55 Score = 87.0 bits (214), Expect = 1e-15 Identities = 39/50 (78%), Positives = 43/50 (86%) Frame = +1 Query: 145 MLSAVIPSVHSYPALPLARQQLHQRYVHPGPLVLGANPLNIPTPTADRDR 294 MLSA+IPS+HSYPA+PLARQ +HQRYVHPGPLVL PL PTPT DRDR Sbjct: 1 MLSALIPSIHSYPAMPLARQLVHQRYVHPGPLVLRTAPLKFPTPTTDRDR 50