BLASTX nr result
ID: Glycyrrhiza24_contig00016428
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza24_contig00016428 (288 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003536085.1| PREDICTED: glutamyl-tRNA(Gln) amidotransfera... 71 1e-10 ref|XP_003556503.1| PREDICTED: glutamyl-tRNA(Gln) amidotransfera... 70 1e-10 ref|XP_003591093.1| Glutamyl-tRNA(Gln) amidotransferase subunit ... 70 2e-10 ref|XP_004135624.1| PREDICTED: amidase 1-like [Cucumis sativus] 59 3e-07 ref|XP_004166037.1| PREDICTED: amidase 1-like [Cucumis sativus] 59 4e-07 >ref|XP_003536085.1| PREDICTED: glutamyl-tRNA(Gln) amidotransferase subunit A-like [Glycine max] Length = 433 Score = 70.9 bits (172), Expect = 1e-10 Identities = 32/40 (80%), Positives = 38/40 (95%) Frame = +1 Query: 1 QVSIPLGMYNKLPVSVSLVARHGADRFLLHLVQSLFDNTE 120 QVSIPLGMYN LP+S+SLVARHGAD+FLLHLV+SL+D+ E Sbjct: 383 QVSIPLGMYNNLPLSISLVARHGADKFLLHLVESLYDSIE 422 >ref|XP_003556503.1| PREDICTED: glutamyl-tRNA(Gln) amidotransferase subunit A-like [Glycine max] Length = 433 Score = 70.5 bits (171), Expect = 1e-10 Identities = 32/38 (84%), Positives = 37/38 (97%) Frame = +1 Query: 1 QVSIPLGMYNKLPVSVSLVARHGADRFLLHLVQSLFDN 114 QVSIPLGMYN LP+S+SLVARHGADRFLLHLV+SL+D+ Sbjct: 383 QVSIPLGMYNNLPLSISLVARHGADRFLLHLVESLYDS 420 >ref|XP_003591093.1| Glutamyl-tRNA(Gln) amidotransferase subunit A [Medicago truncatula] gi|355480141|gb|AES61344.1| Glutamyl-tRNA(Gln) amidotransferase subunit A [Medicago truncatula] gi|388518579|gb|AFK47351.1| unknown [Medicago truncatula] Length = 423 Score = 70.1 bits (170), Expect = 2e-10 Identities = 33/41 (80%), Positives = 37/41 (90%) Frame = +1 Query: 1 QVSIPLGMYNKLPVSVSLVARHGADRFLLHLVQSLFDNTEK 123 QVSIPLGMYN LP SVSLVAR+GAD FLLHLV+S++DN EK Sbjct: 383 QVSIPLGMYNDLPASVSLVARNGADEFLLHLVESIYDNIEK 423 >ref|XP_004135624.1| PREDICTED: amidase 1-like [Cucumis sativus] Length = 428 Score = 59.3 bits (142), Expect = 3e-07 Identities = 28/47 (59%), Positives = 37/47 (78%) Frame = +1 Query: 1 QVSIPLGMYNKLPVSVSLVARHGADRFLLHLVQSLFDNTEK*QSTSY 141 QVSIPLG+YN LPVS+SLVA HG+D FLL++V SL++ E+ S+ Sbjct: 382 QVSIPLGLYNGLPVSISLVANHGSDGFLLNVVHSLYNTLEEEVKASF 428 >ref|XP_004166037.1| PREDICTED: amidase 1-like [Cucumis sativus] Length = 428 Score = 58.9 bits (141), Expect = 4e-07 Identities = 27/41 (65%), Positives = 35/41 (85%) Frame = +1 Query: 1 QVSIPLGMYNKLPVSVSLVARHGADRFLLHLVQSLFDNTEK 123 QVSIPLG+YN LPVS+SLVA HG+D FLL++V SL++ E+ Sbjct: 382 QVSIPLGLYNGLPVSISLVANHGSDGFLLNVVHSLYNTLEE 422