BLASTX nr result
ID: Glycyrrhiza24_contig00015764
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza24_contig00015764 (498 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003530985.1| PREDICTED: uncharacterized protein LOC100798... 69 4e-10 ref|XP_003635207.1| PREDICTED: uncharacterized protein LOC100853... 55 8e-06 >ref|XP_003530985.1| PREDICTED: uncharacterized protein LOC100798405 [Glycine max] Length = 64 Score = 68.9 bits (167), Expect = 4e-10 Identities = 33/41 (80%), Positives = 34/41 (82%) Frame = -1 Query: 498 PIPKRGQVKVGIVVGLANSVASIFSRGGRPRGCASPPHLPH 376 PIPKRGQVKVGIVVGLANSV SIFSR RGCA+P HL H Sbjct: 24 PIPKRGQVKVGIVVGLANSVVSIFSRSRATRGCATPTHLAH 64 >ref|XP_003635207.1| PREDICTED: uncharacterized protein LOC100853563 [Vitis vinifera] Length = 60 Score = 54.7 bits (130), Expect = 8e-06 Identities = 27/29 (93%), Positives = 28/29 (96%) Frame = -1 Query: 498 PIPKRGQVKVGIVVGLANSVASIFSRGGR 412 PIPKRGQVKVGIVVGLA+SVASIFS GGR Sbjct: 22 PIPKRGQVKVGIVVGLAHSVASIFSLGGR 50