BLASTX nr result
ID: Glycyrrhiza24_contig00015177
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza24_contig00015177 (207 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_001238029.1| uncharacterized protein LOC100499666 [Glycin... 74 1e-11 tpg|DAA51759.1| TPA: AP-1 complex subunit sigma-2 [Zea mays] 72 6e-11 ref|XP_003558245.1| PREDICTED: AP-1 complex subunit sigma-1-like... 72 6e-11 ref|XP_003558244.1| PREDICTED: AP-1 complex subunit sigma-1-like... 72 6e-11 gb|ACN28280.1| unknown [Zea mays] gi|414873201|tpg|DAA51758.1| T... 72 6e-11 >ref|NP_001238029.1| uncharacterized protein LOC100499666 [Glycine max] gi|255625661|gb|ACU13175.1| unknown [Glycine max] Length = 161 Score = 73.9 bits (180), Expect = 1e-11 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +1 Query: 100 MINFVLLISRQGKVRLTKWYSPYSQKERSKVIRELS 207 MINFVLLISRQGKVRLTKWYSPYSQKERSKVIRELS Sbjct: 1 MINFVLLISRQGKVRLTKWYSPYSQKERSKVIRELS 36 >tpg|DAA51759.1| TPA: AP-1 complex subunit sigma-2 [Zea mays] Length = 228 Score = 71.6 bits (174), Expect = 6e-11 Identities = 34/36 (94%), Positives = 36/36 (100%) Frame = +1 Query: 100 MINFVLLISRQGKVRLTKWYSPYSQKERSKVIRELS 207 MINFVLLISRQGKVRLTKWYSPY+QKER+KVIRELS Sbjct: 68 MINFVLLISRQGKVRLTKWYSPYTQKERTKVIRELS 103 >ref|XP_003558245.1| PREDICTED: AP-1 complex subunit sigma-1-like isoform 2 [Brachypodium distachyon] Length = 168 Score = 71.6 bits (174), Expect = 6e-11 Identities = 34/36 (94%), Positives = 36/36 (100%) Frame = +1 Query: 100 MINFVLLISRQGKVRLTKWYSPYSQKERSKVIRELS 207 MINFVLLISRQGKVRLTKWYSPY+QKER+KVIRELS Sbjct: 1 MINFVLLISRQGKVRLTKWYSPYTQKERTKVIRELS 36 >ref|XP_003558244.1| PREDICTED: AP-1 complex subunit sigma-1-like isoform 1 [Brachypodium distachyon] Length = 161 Score = 71.6 bits (174), Expect = 6e-11 Identities = 34/36 (94%), Positives = 36/36 (100%) Frame = +1 Query: 100 MINFVLLISRQGKVRLTKWYSPYSQKERSKVIRELS 207 MINFVLLISRQGKVRLTKWYSPY+QKER+KVIRELS Sbjct: 1 MINFVLLISRQGKVRLTKWYSPYTQKERTKVIRELS 36 >gb|ACN28280.1| unknown [Zea mays] gi|414873201|tpg|DAA51758.1| TPA: AP-1 complex subunit sigma-2 [Zea mays] Length = 161 Score = 71.6 bits (174), Expect = 6e-11 Identities = 34/36 (94%), Positives = 36/36 (100%) Frame = +1 Query: 100 MINFVLLISRQGKVRLTKWYSPYSQKERSKVIRELS 207 MINFVLLISRQGKVRLTKWYSPY+QKER+KVIRELS Sbjct: 1 MINFVLLISRQGKVRLTKWYSPYTQKERTKVIRELS 36